BLAST Results
Edit and Resubmit [Sign in above to save your search strategy] How to read this page Blast report description

PSI blast Iteration 1

Job title: P49789:RecName: Full=Bis(5'-adenosyl)-triphosphatase;...

RID
1D77B5AH01R (Expires on 11-24 17:03 pm)
Query ID
P49789.3
Description
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
Molecule type
amino acid
Query Length
147
Database Name
swissprot
Description
Non-redundant UniProtKB/SwissProt sequences
Program
BLASTP 2.7.1+

New Analyze your query with SmartBLAST

Alignments

GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
P49789.3

Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
303 bits(776) 7e-107() Compositional matrix adjust. 147/147(100%) 147/147(100%) 0/147(0%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
Sbjct  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
            TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
Sbjct  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120

Query  121  DKEDFPASWRSEEEMAAEAAALRVYFQ  147
            DKEDFPASWRSEEEMAAEAAALRVYFQ
Sbjct  121  DKEDFPASWRSEEEMAAEAAALRVYFQ  147


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
O89106.31501
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
253 bits(647) 4e-87() Compositional matrix adjust. 134/149(90%) 139/149(93%) 2/149(1%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERF DL PDEVADLFQ
Sbjct  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
             TQRVGTVVEKHF GTS+TFSMQDGPEAGQTVKHVHVHVLPRKAGDF RND+IY+ELQKH
Sbjct  61   VTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKH  120

Query  121  DK--EDFPASWRSEEEMAAEAAALRVYFQ  147
            D+  ED PA WRSE+EMAAEA ALRVYFQ
Sbjct  121  DREEEDSPAFWRSEKEMAAEAEALRVYFQ  149


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
Q9JIX3.11501
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
253 bits(646) 6e-87() Compositional matrix adjust. 130/149(87%) 138/149(92%) 2/149(1%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSF+FGQHLIKPSVVFLKTELSFALVNRKPVVPGHVL+CPLRPVERF DLRPDEVADLFQ
Sbjct  1    MSFKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
             TQRVGTVVEKHF GTS+TFSMQDGPEAGQTVKHVHVH+LPRK+GDF RND+IY+ELQKH
Sbjct  61   VTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRRNDNIYDELQKH  120

Query  121  DK--EDFPASWRSEEEMAAEAAALRVYFQ  147
            D+  ED PA WRSEEEMAAEA  LR YFQ
Sbjct  121  DREEEDSPAFWRSEEEMAAEAEVLRAYFQ  149


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
Q1KZG4.11491
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
252 bits(643) 1e-86() Compositional matrix adjust. 133/149(89%) 139/149(93%) 2/149(1%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERF D+ P+EVADLFQ
Sbjct  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
              QRVGTVVEKHF GTSLTFSMQDGPEAGQTVKHVHVH+LPRKAGDFHRNDSIY+ L+KH
Sbjct  61   AAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKH  120

Query  121  DKE--DFPASWRSEEEMAAEAAALRVYFQ  147
            D+E  D PA WRSEEEMAAEAAALRVYFQ
Sbjct  121  DREDKDSPALWRSEEEMAAEAAALRVYFQ  149


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein homolog
Q86KK2.11491
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
155 bits(391) 3e-48() Compositional matrix adjust. 76/143(53%) 99/143(69%) 6/143(4%)
Query  5    FGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQR  64
            FG  LI+ S +F  TELSFALVN KPV+PGHVLVCP R V R  DL  +E  DL+ + QR
Sbjct  6    FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQR  65

Query  65   VGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKED  124
            + +VVE+HF+G  +TF++QDG  AGQTV+HVH+H++PRK  DF  ND IY E++K  +  
Sbjct  66   ISSVVEEHFNGDGITFAIQDGKNAGQTVEHVHIHIIPRKKFDFENNDQIYNEIEKEREP-  124

Query  125  FPASWRSEEEMAAEAAALRVYFQ  147
                 RS EEM  E++ LR  F+
Sbjct  125  -----RSYEEMEKESSELRPLFE  142



PreferencesTurn off
External link. Please review our privacy policy.