BLAST Results
Edit and Resubmit [Sign in above to save your search strategy] How to read this page Blast report description

PSI blast Iteration 2

Job title: P49789:RecName: Full=Bis(5'-adenosyl)-triphosphatase;...

Skip to the first new sequence
RID
1D7AC6WM01R (Expires on 11-24 17:05 pm)
Query ID
P49789.3
Description
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
Molecule type
amino acid
Query Length
147
Database Name
swissprot
Description
Non-redundant UniProtKB/SwissProt sequences
Program
BLASTP 2.7.1+

New Analyze your query with SmartBLAST

Alignments

GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
P49789.3

Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
190 bits(482) 4e-62() Composition-based stats. 147/147(100%) 147/147(100%) 0/147(0%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
Sbjct  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
            TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
Sbjct  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120

Query  121  DKEDFPASWRSEEEMAAEAAALRVYFQ  147
            DKEDFPASWRSEEEMAAEAAALRVYFQ
Sbjct  121  DKEDFPASWRSEEEMAAEAAALRVYFQ  147


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
Q1KZG4.11491
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
190 bits(482) 4e-62() Composition-based stats. 133/149(89%) 139/149(93%) 2/149(1%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERF D+ P+EVADLFQ
Sbjct  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
              QRVGTVVEKHF GTSLTFSMQDGPEAGQTVKHVHVH+LPRKAGDFHRNDSIY+ L+KH
Sbjct  61   AAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKH  120

Query  121  DKE--DFPASWRSEEEMAAEAAALRVYFQ  147
            D+E  D PA WRSEEEMAAEAAALRVYFQ
Sbjct  121  DREDKDSPALWRSEEEMAAEAAALRVYFQ  149


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
Q9JIX3.11501
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
189 bits(481) 8e-62() Composition-based stats. 130/149(87%) 138/149(92%) 2/149(1%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSF+FGQHLIKPSVVFLKTELSFALVNRKPVVPGHVL+CPLRPVERF DLRPDEVADLFQ
Sbjct  1    MSFKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
             TQRVGTVVEKHF GTS+TFSMQDGPEAGQTVKHVHVH+LPRK+GDF RND+IY+ELQKH
Sbjct  61   VTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRRNDNIYDELQKH  120

Query  121  DK--EDFPASWRSEEEMAAEAAALRVYFQ  147
            D+  ED PA WRSEEEMAAEA  LR YFQ
Sbjct  121  DREEEDSPAFWRSEEEMAAEAEVLRAYFQ  149


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bis(5'-adenosyl)-triphosphatase; AltName: Full=AP3A hydrolase; Short=AP3Aase; AltName: Full=Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; AltName: Full=Dinucleosidetriphosphatase; AltName: Full=Fragile histidine triad protein
O89106.31501
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
187 bits(475) 5e-61() Composition-based stats. 134/149(90%) 139/149(93%) 2/149(1%)
Query  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ  60
            MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERF DL PDEVADLFQ
Sbjct  1    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQ  60

Query  61   TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH  120
             TQRVGTVVEKHF GTS+TFSMQDGPEAGQTVKHVHVHVLPRKAGDF RND+IY+ELQKH
Sbjct  61   VTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKH  120

Query  121  DK--EDFPASWRSEEEMAAEAAALRVYFQ  147
            D+  ED PA WRSE+EMAAEA ALRVYFQ
Sbjct  121  DREEEDSPAFWRSEKEMAAEAEALRVYFQ  149


GenPeptGraphics Next Previous Descriptions
RecName: Full=Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT; AltName: Full=Fragile histidine triad protein; AltName: Full=Purine nucleoside phosphoramidase FHIT
F4KEV7.11801
Alignment statistics for match #1
ScoreExpectMethodIdentitiesPositivesGapsFrame
187 bits(475) 2e-60() Composition-based stats. 76/153(50%) 101/153(66%) 7/153(4%)
Query  2    SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQT  61
            S+ FG + I P  VF  T LS+A+VN +P++P HVLVCP R V RF DL  DE +DL+ T
Sbjct  27   SYAFGPYKIDPREVFYATPLSYAMVNLRPLLPAHVLVCPRRLVPRFTDLTADETSDLWLT  86

Query  62   TQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHD  121
             Q+VG+ +E   + +SLT ++QDGP+AGQTV HVH+H+LPRK GDF +ND IY+ L + +
Sbjct  87   AQKVGSKLETFHNASSLTLAIQDGPQAGQTVPHVHIHILPRKGGDFEKNDEIYDALDEKE  146

Query  122  KE-------DFPASWRSEEEMAAEAAALRVYFQ  147
            KE       D     RS +EMA EA+  R  F 
Sbjct  147  KELKQKLDLDKDRVDRSIQEMADEASQYRSLFD  179



PreferencesTurn off
External link. Please review our privacy policy.