1-BIN-301, 2-AIN-501 Methods in Bioinformatics, 2021/22

Introduction · Rules · Tasks and dates · Materials · Moodle · Discussion
Cvičenia vo štvrtok o 14:00 sú určené pre študentov BIN, INF, mINF, mAIN, DAV. Cvičenia vo štvrtok o 17:20 sú pre študentov z PriFUK a z fyzikálnych odborov. Obidvoje cvičenia sa budú konať už v prvom týždni semestra.


MBI 2013/2014: Rozdiel medzi revíziami

Z MBI
Prejsť na: navigácia, hľadanie
 
(One intermediate revision by the same user not shown)
Riadok 660: Riadok 660:
 
==Skorovacie matice==
 
==Skorovacie matice==
  
Chceme urcit skorovaciu schemu pre zarovnavanie dvoch DNA sekvencii (bez medzier). Mame dva modely, kazdy z nich vie vygenerovat 2 zarovnane skevencie dlzky n.
+
Chceme urcit skorovaciu schemu pre zarovnavanie dvoch DNA sekvencii (bez medzier). Mame dva modely, kazdy z nich vie vygenerovat 2 zarovnane sekvencie dlzky n.
  
 
'''Model R (random)''' reprezentuje nezavisle nahodne sekvencie
 
'''Model R (random)''' reprezentuje nezavisle nahodne sekvencie
Riadok 897: Riadok 897:
 
* porovnanie lokalneho a globalneho zarovnania
 
* porovnanie lokalneho a globalneho zarovnania
 
** Dva proteiny s kinase doménou zarovnáme lokálne, globálne a globálne s tým, že neplatíme za medzery na koncoch
 
** Dva proteiny s kinase doménou zarovnáme lokálne, globálne a globálne s tým, že neplatíme za medzery na koncoch
** [[Proteínové skevencie a zarovnania|Subor s datami a vysledkami]]
+
** [[#Proteínové sekvencie a zarovnania|Subor s datami a vysledkami]]
 
<pre>
 
<pre>
 
>sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2
 
>sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2
 
>tr|B1AKP8|B1AKP8_HUMAN FK506 binding protein 12-rapamycin associated protein 1 OS=Homo sapiens GN=FRAP1 PE=4 SV=1
 
>tr|B1AKP8|B1AKP8_HUMAN FK506 binding protein 12-rapamycin associated protein 1 OS=Homo sapiens GN=FRAP1 PE=4 SV=1
 
</pre>
 
</pre>
 +
 +
===Proteínové sekvencie a zarovnania===
 +
<pre>
 +
>sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2
 +
MDRLVFSYCPSSKVTARFLVKFCFIEYQDSQEPCICTIQLFSGNESGSLMQKCFVSKIPN
 +
KSLLPTELSKISTHEWLDFGVTVSELSLNAKFVVSAWKPSFNDEEVYEFVGCTTYRLFDE
 +
NNLLRQGLQKIPLQTSKEIKKYSPTSLELEQVKEINRLDGLLLKLQLGDVPSVNWLDDIS
 +
FGKIKDFRSKHMSLVTIPILYLDFLQFSFPVVFQRSYYPKSENRVYYSSFDLELNLDSPA
 +
ELKHRRLVRSQRNGPLDKDLKPNSKIRKELESILSYPPSEELSLEEKDLIWKFRFYLTRN
 +
KKAMTKFLKSVVWTDSSEVNQALSLLDSWTEIDIDDALELLSPSFVHPKVRAYAVSRLET
 +
ASNEELLLYLLQLVQALRYDNPISSDERFQPSPLALFLVNRAISSPSIGNDLYWYLVVEI
 +
EDEPVSKLFSSVMFLFQKELSKSVEGRLIRETLSAQAKFVEKLLRISKSVQSFRGTRLKK
 +
IEYLKVLLEDHKYHLLDFHALPLPLDPSVNIVGIIPDACTVFKSTMQPLRLLFKCQDGSK
 +
YPIIFKNGDDLRQDQLVIQILTLMDKLLKKEKLDLHLKPYRILATGPTHGAVQFVPSKTL
 +
ATILAEYHGSVLAYLRENNPDDGLNSANYGIDPVAMDNYVRSCAGYCVITYLLGVGDRHL
 +
DNLLITKDGHFFHADFGYILGRDPKLFSPAMKLSKEMVEGMGGYNSPFYQQFKSYCYTTF
 +
TALRKSSNLILNLFSLMVDANIPDIKFDKEKVVYKVKERFCLQMSESDAIKYFEQLINDS
 +
VSALFPQIIDRMHNLAQYMRS
 +
</pre>
 +
 +
<pre>
 +
>tr|B1AKP8|B1AKP8_HUMAN FK506 binding protein 12-rapamycin associated protein 1 OS=Homo sapiens GN=FRAP1 PE=4 SV=1
 +
MNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAES
 +
TENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGH
 +
WPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYP
 +
LTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEAS
 +
RLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVK
 +
DLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQS
 +
IAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTS
 +
LRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDY
 +
DHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILG
 +
LGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGN
 +
YRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSV
 +
EILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSH
 +
DDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
 +
</pre>
 +
 +
<pre>
 +
########################################
 +
# Program: water
 +
# Rundate: Thu 11 Oct 2012 09:37:58
 +
# Commandline: water
 +
#    -asequence ggg1
 +
#    -bsequence ggg2
 +
#    -outfile ggg12.w
 +
# Align_format: srspair
 +
# Report_file: ggg12.w
 +
########################################
 +
 +
#=======================================
 +
#
 +
# Aligned_sequences: 2
 +
# 1: VPS34_SCHPO
 +
# 2: B1AKP8_HUMAN
 +
# Matrix: EBLOSUM62
 +
# Gap_penalty: 10.0
 +
# Extend_penalty: 0.5
 +
#
 +
# Length: 645
 +
# Identity:    124/645 (19.2%)
 +
# Similarity:  221/645 (34.3%)
 +
# Gaps:        211/645 (32.7%)
 +
# Score: 226.0
 +
#
 +
#
 +
#=======================================
 +
 +
VPS34_SCHPO      235 NLDSPAELKHRRLVRSQRNGPLDKDLKPNSKIRKELESILSYPPSEELSL    284
 +
                    |.:|.||        |..|.|....|:  .|:.::|...|         
 +
B1AKP8_HUMAN      53 NSESEAE--------STENSPTPSPLQ--KKVTEDLSKTL----------    82
 +
 +
VPS34_SCHPO      285 EEKDLIWKFRFYLTRNKKAMTKFLKSVVWTDSSEVNQALSLLDSWTEI--    332
 +
                                |.....|:..|.:|:..:..:.:...|.:|..|.:. 
 +
B1AKP8_HUMAN      83 ------------LMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGH    120
 +
 +
VPS34_SCHPO      333 --DIDDALELLSPSFVHPKVRAYAVSRLETASNEELLLYLLQLVQAL--R    378
 +
                      |:::||          |......:::|        .||::..|  |
 +
B1AKP8_HUMAN    121 WPDVNEAL-----------VEGVKAIQIDT---------WLQVIPQLIAR    150
 +
 +
VPS34_SCHPO      379 YDNP-----------ISSDERFQPS----PLAL-----------------    396
 +
                    .|.|          ::...|:.|.    ||.:               
 +
B1AKP8_HUMAN    151 IDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKIL    200
 +
 +
VPS34_SCHPO      397 --------FLVNRA--ISSPSIGNDLYWYLVVEIEDEPVSKLF---SSVM    433
 +
                            .||.:|  :|...|...:.|:.:.....|..|:|:  .:|.
 +
B1AKP8_HUMAN    201 KNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVK    250
 +
 +
VPS34_SCHPO      434 FLFQ----------------KELS-----------------KSVEGRLIR    450
 +
                    .:|:                ||.|                |.::...::
 +
B1AKP8_HUMAN    251 GMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVK    300
 +
 +
VPS34_SCHPO      451 ETLSAQAKFVEKLLRISKSVQSFRGTRLKKIEYLKVLLEDHKYHLLDFHA    500
 +
                    :...|...:.....||||.:.......|:.:....::..|.:.      |
 +
B1AKP8_HUMAN    301 DLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLEL------A    344
 +
 +
VPS34_SCHPO      501 LPLPLDPSVNIVGI--IPDACTVFKSTMQPLRLLFKCQDGSKYPIIFKNG    548
 +
                    :|...||:..|:.|  |..:..|..|..:|.:|.....:|.::..:.|..
 +
B1AKP8_HUMAN    345 VPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGH    394
 +
 +
VPS34_SCHPO      549 DDLRQDQLVIQILTLMDKLLKKE----KLDLHLKPYRILATGPTHGAVQF    594
 +
                    :|||||:.|:|:..|::.||..:    :.:|.::.|.::......|.:.:
 +
B1AKP8_HUMAN    395 EDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGW    444
 +
 +
VPS34_SCHPO      595 VP-SKTLATILAEYHG-----------------------------SVLAY    614
 +
                    || ..||..::.:|..                            .|..:
 +
B1AKP8_HUMAN    445 VPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEH    494
 +
 +
VPS34_SCHPO      615 LRENNPDDGLNSANYGIDP---VAMD---NYVRSCAGYCVITYLLGVGDR    658
 +
                    ...|...|.|....:...|  |..|  ||.||.|...::.|:||:|||
 +
B1AKP8_HUMAN    495 AVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR    544
 +
 +
VPS34_SCHPO      659 HLDNLLITK-DGHFFHADFG--------------YILGRDPKLFSPAMKL    693
 +
                    |..||::.: .|...|.|||              .|..|..::.:.||:
 +
B1AKP8_HUMAN    545 HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAME-    593
 +
 +
VPS34_SCHPO      694 SKEMVEGMGGYNSPFYQQFKSYCYTTFTALRKSSNLILNLFSLMV    738
 +
                        |.|:.|      .::..|:|....||:..:.::.:....|
 +
B1AKP8_HUMAN    594 ----VTGLDG-------NYRITCHTVMEVLREHKDSVMAVLEAFV    627
 +
</pre>
 +
 +
<pre>
 +
########################################
 +
# Program: needle
 +
# Rundate: Thu 11 Oct 2012 09:40:40
 +
# Commandline: needle
 +
#    -asequence ggg1
 +
#    -bsequence ggg2
 +
#    -endweight
 +
#    -outfile ggg12.n2
 +
# Align_format: srspair
 +
# Report_file: ggg12.n2
 +
########################################
 +
 +
#=======================================
 +
#
 +
# Aligned_sequences: 2
 +
# 1: VPS34_SCHPO
 +
# 2: B1AKP8_HUMAN
 +
# Matrix: EBLOSUM62
 +
# Gap_penalty: 10.0
 +
# Extend_penalty: 0.5
 +
#
 +
# Length: 948
 +
# Identity:    167/948 (17.6%)
 +
# Similarity:  292/948 (30.8%)
 +
# Gaps:        341/948 (36.0%)
 +
# Score: 130.5
 +
#
 +
#
 +
#=======================================
 +
 +
VPS34_SCHPO        1 MD-RLVFSYCPSSKVTARFLVKFCFIEYQDSQEPCICTIQLFSGNESGSL    49
 +
                    |: ..|..|                ::|:            ...:....
 +
B1AKP8_HUMAN      1 MNFEAVLHY-----------------KHQN------------QARDEKKK    21
 +
 +
VPS34_SCHPO      50 MQKCFVSKIPNKSLLPTELSKISTHEWLDFGVTVSELSLNAKFVVSAWKP    99
 +
                    ::....:.|.|.:...|..:..:|                    :|...
 +
B1AKP8_HUMAN      22 LRHASGANITNATTAATTAATATT---------------------TASTE    50
 +
 +
VPS34_SCHPO      100 SFNDEEVYEFVGCTTYRLFDENNLLRQGLQ-KIPLQTSKEIKKYSPTSLE    148
 +
                    ..|.|...|..        ||:.....|| |:....||.:..|:..:::
 +
B1AKP8_HUMAN      51 GSNSESEAEST---------ENSPTPSPLQKKVTEDLSKTLLMYTVPAVQ    91
 +
 +
VPS34_SCHPO      149 ----LEQVKEINRLDGLLLKLQLGDVPSVNWLDDISFGKIKDFRSKHMSL    194
 +
                        ...:...|.|...|..|.|      |.|  :|...|...  :|
 +
B1AKP8_HUMAN      92 GFFRSISLSRGNNLQDTLRVLTL-------WFD---YGHWPDVNE---AL    128
 +
 +
VPS34_SCHPO      195 VT-IPILYLDFLQFSFPVVFQRSYYPKSENRVYYSSFDLELNLDSP----    239
 +
                    |. :..:.:|......|.:..|                    :|:|   
 +
B1AKP8_HUMAN    129 VEGVKAIQIDTWLQVIPQLIAR--------------------IDTPRPLV    158
 +
 +
VPS34_SCHPO      240 AELKHRRLVRSQRNGPLDKDLKPNSKIRKELESILSYPPSEELSLEEKDL    289
 +
                    ..|.|:.|....|..|                ..|.||    |::..|..
 +
B1AKP8_HUMAN    159 GRLIHQLLTDIGRYHP----------------QALIYP----LTVASKST    188
 +
 +
VPS34_SCHPO      290 IWKFRFYLTRNKKAMTKFLKSVVWTDSSEVNQALSLLDSWTEIDI-----    334
 +
                            .|....|..|.||::....::.|.||:.:.:....:.|   
 +
B1AKP8_HUMAN    189 -------TTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEM    231
 +
 +
VPS34_SCHPO      335 -DDALELLSPSFVHPKVRAYAVSRLETASNEELLLYLLQLVQALRYDNPI    383
 +
                      .:.||..|        |.|...|    |.:.:..:|:.:.|:.   
 +
B1AKP8_HUMAN    232 WHEGLEEAS--------RLYFGER-----NVKGMFEVLEPLHAMM-----    263
 +
 +
VPS34_SCHPO      384 SSDERFQPSPLALFLVNRAISSPSIGNDLYWYLVVEIEDEPVSKLFSSVM    433
 +
                        || .|..|.....|:|    .|.||    :|.           
 +
B1AKP8_HUMAN    264 ---ER-GPQTLKETSFNQA-----YGRDL-----MEA-------------    286
 +
 +
VPS34_SCHPO      434 FLFQKELSKSVEGRLIRETLSAQAKFVEKLLRISKSVQSFRGTRLKKIEY    483
 +
                        |:...|.::...:::...|...:.....||||.:.......|:.:..
 +
B1AKP8_HUMAN    287 ---QEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP    333
 +
 +
VPS34_SCHPO      484 LKVLLEDHKYHLLDFHALPLPLDPSVNIVGI--IPDACTVFKSTMQPLRL    531
 +
                    ..::..|.:.      |:|...||:..|:.|  |..:..|..|..:|.:|
 +
B1AKP8_HUMAN    334 KLLMCRDLEL------AVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKL    377
 +
 +
VPS34_SCHPO      532 LFKCQDGSKYPIIFKNGDDLRQDQLVIQILTLMDKLLKKE----KLDLHL    577
 +
                    .....:|.::..:.|..:|||||:.|:|:..|::.||..:    :.:|.:
 +
B1AKP8_HUMAN    378 TLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSI    427
 +
 +
VPS34_SCHPO      578 KPYRILATGPTHGAVQFVP-SKTLATILAEYHG-----------------    609
 +
                    :.|.::......|.:.:|| ..||..::.:|..               
 +
B1AKP8_HUMAN    428 QRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMA    477
 +
 +
VPS34_SCHPO      610 ------------SVLAYLRENNPDDGLNSANYGIDP---VAMD---NYVR    641
 +
                                .|..:...|...|.|....:...|  |..|  ||.|
 +
B1AKP8_HUMAN    478 PDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTR    527
 +
 +
VPS34_SCHPO      642 SCAGYCVITYLLGVGDRHLDNLLITK-DGHFFHADFG-------------    677
 +
                    |.|...::.|:||:||||..||::.: .|...|.|||           
 +
B1AKP8_HUMAN    528 SLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFP    577
 +
 +
VPS34_SCHPO      678 -YILGRDPKLFSPAMKLSKEMVEGMGGYNSPFYQQFKSYCYTTFTALRKS    726
 +
                      .|..|..::.:.||:    |.|:.|      .::..|:|....||:.
 +
B1AKP8_HUMAN    578 EKIPFRLTRMLTNAME-----VTGLDG-------NYRITCHTVMEVLREH    615
 +
 +
VPS34_SCHPO      727 SNLILNLFSLMV----------DAN-------------------------    741
 +
                    .:.::.:....|          |.|                       
 +
B1AKP8_HUMAN    616 KDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG    665
 +
 +
VPS34_SCHPO      742 --------------IPD----------IK---FDKE--KVVYKVKERFC-    761
 +
                                  :|:          :|  .:|:  :::.:|:::..
 +
B1AKP8_HUMAN    666 VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTG    715
 +
 +
VPS34_SCHPO      762 LQMSESDAI---KYFEQLINDSVSALFPQIIDRMHNLAQYMRS-----    801
 +
                    ...|..|.:  ...|.||..:.|        ..||.|....   
 +
B1AKP8_HUMAN    716 RDFSHDDTLDVPTQVELLIKQATS---------HENLCQCYIGWCPFW    754
 +
</pre>
 +
 +
<pre>
 +
########################################
 +
# Program: needle
 +
# Rundate: Thu 11 Oct 2012 09:37:33
 +
# Commandline: needle
 +
#    -asequence ggg1
 +
#    -bsequence ggg2
 +
#    -outfile ggg12.n
 +
# Align_format: srspair
 +
# Report_file: ggg12.n
 +
########################################
 +
 +
#=======================================
 +
#
 +
# Aligned_sequences: 2
 +
# 1: VPS34_SCHPO
 +
# 2: B1AKP8_HUMAN
 +
# Matrix: EBLOSUM62
 +
# Gap_penalty: 10.0
 +
# Extend_penalty: 0.5
 +
#
 +
# Length: 1060
 +
# Identity:    138/1060 (13.0%)
 +
# Similarity:  245/1060 (23.1%)
 +
# Gaps:        565/1060 (53.3%)
 +
# Score: 206.0
 +
#
 +
#
 +
#=======================================
 +
 +
VPS34_SCHPO        1 MDRLVFSYCPSSKVTARFLVKFCFIEYQDSQEPCICTIQLFSGNESGSLM    50
 +
                                                                     
 +
B1AKP8_HUMAN      0 --------------------------------------------------      0
 +
 +
VPS34_SCHPO      51 QKCFVSKIPNKSLLPTELSKISTHEWLDFGVTVSELSLNAKFVVSAWKPS    100
 +
                                                                     
 +
B1AKP8_HUMAN      0 --------------------------------------------------      0
 +
 +
VPS34_SCHPO      101 FNDEEVYEFVGCTTYRLFDENNLLRQGLQKIPLQTSKEIKKYSPTSLELE    150
 +
                                                                     
 +
B1AKP8_HUMAN      0 --------------------------------------------------      0
 +
 +
VPS34_SCHPO      151 QVKEINRLDGLLLKLQLGDVPSVNWLDDISFGKIKDFRSKHMSLVTIPIL    200
 +
                                                                     
 +
B1AKP8_HUMAN      0 --------------------------------------------------      0
 +
 +
VPS34_SCHPO      201 YLDFLQFSFPVVFQRSYYPKSENRVYYSSFDLELNLDSPAELKHRRLVRS    250
 +
                                                      :|.::....||:...|.
 +
B1AKP8_HUMAN      1 ---------------------------------MNFEAVLHYKHQNQARD    17
 +
 +
VPS34_SCHPO      251 QRNGPLDKDLK--------------------------PNSKIRKELESIL    274
 +
                    ::    |.|:                          ..|....|.||..
 +
B1AKP8_HUMAN      18 EK-----KKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTE    62
 +
 +
VPS34_SCHPO      275 SYP-PSEELSLEEKDLIWKFRFYLTRNKKAMTKFLKSVVWTDSSEVNQAL    323
 +
                    :.| ||.......:||......|..  .|:..|.:|:..:..:.:...|
 +
B1AKP8_HUMAN      63 NSPTPSPLQKKVTEDLSKTLLMYTV---PAVQGFFRSISLSRGNNLQDTL    109
 +
 +
VPS34_SCHPO      324 SLLDSWTEI----DIDDALELLSPSFVHPKVRAYAVSRLETASNEELLLY    369
 +
                    .:|..|.:.    |:::||          |......:::|       
 +
B1AKP8_HUMAN    110 RVLTLWFDYGHWPDVNEAL-----------VEGVKAIQIDT---------    139
 +
 +
VPS34_SCHPO      370 LLQLVQAL--RYDNP-----------ISSDERFQPS----PLAL------    396
 +
                    .||::..|  |.|.|          ::...|:.|.    ||.:     
 +
B1AKP8_HUMAN    140 WLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTT    189
 +
 +
VPS34_SCHPO      397 -------------------FLVNRA--ISSPSIGNDLYWYLVVEIEDEPV    425
 +
                                        .||.:|  :|...|...:.|:.:.....|..
 +
B1AKP8_HUMAN    190 TARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEA    239
 +
 +
VPS34_SCHPO      426 SKLF---SSVMFLFQ----------------KELS---------------    441
 +
                    |:|:  .:|..:|:                ||.|             
 +
B1AKP8_HUMAN    240 SRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEW    289
 +
 +
VPS34_SCHPO      442 --KSVEGRLIRETLSAQAKFVEKLLRISKSVQSFRGTRLKKIEYLKVLLE    489
 +
                      |.::...:::...|...:.....||||.:.......|:.:....::..
 +
B1AKP8_HUMAN    290 CRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCR    339
 +
 +
VPS34_SCHPO      490 DHKYHLLDFHALPLPLDPSVNIVGI--IPDACTVFKSTMQPLRLLFKCQD    537
 +
                    |.:.      |:|...||:..|:.|  |..:..|..|..:|.:|.....:
 +
B1AKP8_HUMAN    340 DLEL------AVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSN    383
 +
 +
VPS34_SCHPO      538 GSKYPIIFKNGDDLRQDQLVIQILTLMDKLLKKE----KLDLHLKPYRIL    583
 +
                    |.::..:.|..:|||||:.|:|:..|::.||..:    :.:|.::.|.::
 +
B1AKP8_HUMAN    384 GHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVI    433
 +
 +
VPS34_SCHPO      584 ATGPTHGAVQFVP-SKTLATILAEYHG-----------------------    609
 +
                    ......|.:.:|| ..||..::.:|..                     
 +
B1AKP8_HUMAN    434 PLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHL    483
 +
 +
VPS34_SCHPO      610 ------SVLAYLRENNPDDGLNSANYGIDP---VAMD---NYVRSCAGYC    647
 +
                          .|..:...|...|.|....:...|  |..|  ||.||.|...
 +
B1AKP8_HUMAN    484 TLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMS    533
 +
 +
VPS34_SCHPO      648 VITYLLGVGDRHLDNLLITK-DGHFFHADFG--------------YILGR    682
 +
                    ::.|:||:||||..||::.: .|...|.|||              .|..|
 +
B1AKP8_HUMAN    534 MVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFR    583
 +
 +
VPS34_SCHPO      683 DPKLFSPAMKLSKEMVEGMGGYNSPFYQQFKSYCYTTFTALRKSSNLILN    732
 +
                    ..::.:.||:    |.|:.|      .::..|:|....||:..:.::.
 +
B1AKP8_HUMAN    584 LTRMLTNAME-----VTGLDG-------NYRITCHTVMEVLREHKDSVMA    621
 +
 +
VPS34_SCHPO      733 LFSLMV----------DANIPDIKFDKEKVVYKVKERFCLQMSESDAIKY    772
 +
                    :....|          |.|....|..:.:                   
 +
B1AKP8_HUMAN    622 VLEAFVYDPLLNWRLMDTNTKGNKRSRTR---------------------    650
 +
 +
VPS34_SCHPO      773 FEQLINDSVSA-LFPQIIDRMHNLAQYMRS--------------------    801
 +
                          .||.|| ...:|:|.: .|.:....                   
 +
B1AKP8_HUMAN    651 -----TDSYSAGQSVEILDGV-ELGEPAHKKTGTTVPESIHSFIGDGLVK    694
 +
 +
VPS34_SCHPO      801 --------------------------------------------------    801
 +
                                                                     
 +
B1AKP8_HUMAN    695 PEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLC    744
 +
 +
VPS34_SCHPO      801 ----------    801
 +
                             
 +
B1AKP8_HUMAN    745 QCYIGWCPFW    754
 +
<pre>
  
 
===NCBI Blast===
 
===NCBI Blast===

Aktuálna revízia z 21:09, 1. október 2014

Obsah

Sekvenovanie genómov, cvičenia pre informatikov

Uvod do pravdepodobnosti

  • Myslienkovy experiment, v ktorom vystupuje nahoda, napr. hod idealnou kockou/korunou
  • Vysledkom experimentu je nejaka hodnota (napr. cislo, alebo aj niekolko cisel, retazec)
  • Tuto neznamu hodnotu budeme volat nahodna premenna
  • Zaujima nas pravdepodobnost, s akou nahodna premenna nadobuda jednotlive mozne hodnoty
  • T.j. ak experiment opakujeme vela krat, ako casto uvidime nejaky vysledok
  • Priklad 1: hodime idealizovanou kockou, premenna X bude hodnota, ktoru dostaneme
  • Mozne hodnoty 1,2,..,6, kazda rovnako pravdepodobna
  • Piseme napr. Pr(X=2)=1/6
  • Priklad 2: hodime 2x kockou, nahodna premenna X bude sucet hodnot, ktore dostaneme
  • Mozne hodnoty: 2,3,...,12
  • Kazda dvojica hodnot na kocke rovnako pravdepodobna, t.j. pr. 1/36
  • Sucet 5 mozeme dostat 1+4,2+3,3+2,4+1 - t.j. P(X=5) = 4/36
  • Sucet 11 mozeme dostat 5+6 alebo 6+5, t.j. P(X=11) = 2/36
  • Rozdelenie pravdepodobnosti: (tabulka udavajuca pravdepodobnost pre kazdu moznu hodnotu)
hodnota i:   2     3     4     5     6     7     8     9     10    11    12
Pr(X=i):    1/36  2/36  3/36  4/36  5/36  6/36  5/36  5/36  6/36  5/36  1/36
  • Overte, ze sucet pravdepodobnosti je 1
  • Stredna hodnota E(X):
    • priemer z moznych hodnot vahovanych ich pravdepodobnostami
    • v nasom priklade E(X)=2\cdot {\frac  {1}{36}}+3\cdot {\frac  {2}{36}}+4\cdot {\frac  {3}{36}}+5\cdot {\frac  {4}{36}}+6\cdot {\frac  {5}{36}}+7\cdot {\frac  {6}{36}}+8\cdot {\frac  {5}{36}}+9\cdot {\frac  {4}{36}}+10\cdot {\frac  {3}{36}}+11\cdot {\frac  {2}{36}}+12\cdot {\frac  {1}{36}}=7
  • Ak by sme experiment opakovali vela krat a zratali priemer hodnot X, ktore nam vysli, dostali by sme cislo blizke E(X)
  • Iny vypocet strednej hodnoty:
    • X=X1+X2, kde X1 je hodnota na prvej kocke a X2 je hodnota na druhej kocke
    • E(X_{1})=1\cdot {\frac  {1}{6}}+...+6\cdot {\frac  {1}{6}}=3.5, podobne aj E(X2) = 3.5
    • Plati, ze E(X1+X2)=E(X1) + E(X2) a teda E(X) = 3.5 + 3.5 = 7
    • Pozor, pre sucin a ine funkcie taketo vztahy platit nemusia, napr. E(X_{1}\cdot X_{2}) nie je vzdy E(X_{1})\cdot E(X_{2})

Pocitanie pokrytia genomov

  • Pozrite tiez grafy k pravdepodobnosti: http://compbio.fmph.uniba.sk/vyuka/mbi/poznamky/ci02.pdf
  • Nas problem: spocitanie pokrytia
    • G = dlzka genomu, napr. 1 000 000 (predpokladajme, že je cirkulárny)
    • N = pocet segmentov (readov), napr. 10 000
    • L = dlzka readu, napr. 1000
    • Celkova dlzka segmentov NL, pokrytie (coverage) NL/G, v nasom pripade 10x
    • V priemere kazda baza pokryta 10x
    • Niektore su ale pokryte viackrat, ine menej.
    • Zaujimaju nas otazky typu: kolko baz ocakavame, ze bude pokrytych menej ako 3x?
    • Dolezite pri planovani experimentov (ake velke pokrytie potrebujem na dosiahnutie urcitej kvality)
  • Pokrytie genomu: predpokladame, ze kazdy segment zacina na nahodnej pozicii zo vsetkych moznych G
  • Takze ak premenna Y_i bude zaciatok i-teho segmentu, jej rozdelenie bude rovnomerne
    • P(Y_i=1) = P(Y_i=2) = ... = P(Y_i=G) = 1/G
  • Aka je pravdepodobnost ze nejaky konkretny i-ty segment pokryva konkretnu poziciu j?
    • P(Y_i>=j-L+1 and Y_i<=j) = P(Y_i=j-L+1)+...+P(Y_i=j) = L/G, oznacme tuto hodnotu p, nasom priklade p=0.001 (1 promile)
  • Uvazujme premennu X_j, ktora udava pocet segmentov pokryvajucich poziciu j
    • mozne hodnoty 0..N
    • i-ty segment pretina poziciu j s pravdepodobnostou p=L/G
    • to iste ako keby sme N krat hodili mincou, na ktorej spadne hlava s pravd. p a znak 1-p a oznacili ako X_j pocet hlav
    • Priklad: majme mincu, ktora ma hlavu s pr. 1/4 a hodime ju 3x.
HHH 1/64
HHT 3/64
HTH 3/64
HTT 9/64
THH 3/64
THT 9/64
TTH 9/64
TTT 27/64
  • P(X_j=3) = 1/64, P(X_j=2)=9/64, P(X_j=1)=27/64, P(X_j=0)=27/64
    • taketo rozdelenie pravdepodobnosti sa vola binomicke
    • P(X_j = k) = (N choose k) p^k (1-p)^(N-k), kde {N \choose k}={\frac  {N!}{k!(N-k)!}} a n! = 1*2*...*n
    • napr pre priklad s troma hodmi kockou P(X_j=2) = 3!/(2!*1!) * (1/4)^2 * (3/4)^1 = 9/64
    • Zle sa pocita pre velke N, preto sa niekedy pouziva aproximacia Poissonovym rozdelenim s parametrom lambda = Np, ktore ma P(X_{j}=k)=e^{{-\lambda }}\lambda ^{k}/k!
    • Spat k sekvenovaniu: vieme spocitat rozdelenie pravdepodobnosti a tiez napr. P(X_i<3) = P(X_i=0)+P(X_i=1)+P(X_i=2) = 0.000045+0.00045+0.0023=0.0028 (v priemere ocakavame 45 baz nepokrytych, 2800 pokrytých menej ako 3 krát)
    • Takyto graf, odhad, vieme lahko spravit pre rozne pocty segmentov a tak naplanovat, kolko segmentov potrebujeme
  • Chceme tiez odhadnut pocet kontigov (podla clanku Lander a Waterman 1988) (nerobili sme)
    • Ak niekolko baz vobec nie je pokrytych segmentami, prerusi sa kontig
    • Vieme, kolko baz je v priemere nepokrytych, ale niektore mozu byt vedla seba
    • Novy kontig vznikne aj ak sa susedne segmenty malo prekryvaju
    • Predpokladajme, ze na spojenie dvoch segmentov potrebujeme prekryv aspon T=50
    • Aka je pravdepodobnost, ze dany segment i bude posledny v kontigu?
    • Ziaden segment j!=i nesmie zacinat v prvych L-T bazach kontigu i
    • Kazdy segment tam zacina s pravdepodobnostou (L-T)/G, v priemere ich tam zacne N(L-T)/G
    • Pouzijeme Poissonovo rozdelenie pre \lambda =N(L-T)/G a k=0, t.j. pravdepodobnost, ze tam nezacne ziaden je zhruba exp(-N(L-T)/G)
    • Pre N segmentov dostaneme priemerny pocet kontigov N*exp(-N(L-T)/G)
    • Ako keby sme dlzku segmentu skratili o dlzku prekryvu
    • Pre T=50 dostaneme priemerny pocet koncov kontigov 0.75 (ak pokryjeme cely kruh, mame nula koncov, preto je hodnota mensia ako 1). Ak znizime N na 5000 (5x pokrytie) dostaneme 43 kontigov
  • Moze sa zdat zvlastne, ze pri priemernom pocte nepokrytych baz 45 mame pocet koncov v priemere menej ako jedna. Situacia je vsak taka, ze pri opakovaniach tohto experimentu casto dostavame jeden suvisly kontig, ale ak je uz aspon jeden koniec kontigu, byva tam pomerne velka medzera. Tu je napriklad 50 opakovani expertimentu s T=0, priemerny pocet koncov je 0.55, priemerny pocet nepokrytych baz je 49.
empty: 0 last: 0            empty: 0 last: 0	   empty: 0 last: 0      
empty: 274 last: 2	    empty: 282 last: 1	   empty: 0 last: 0      
empty: 0 last: 0	    empty: 0 last: 0	   empty: 8 last: 1      
empty: 0 last: 0	    empty: 12 last: 1	   empty: 0 last: 0      
empty: 122 last: 1	    empty: 135 last: 1	   empty: 111 last: 1    
empty: 13 last: 1	    empty: 1 last: 1	   empty: 56 last: 1     
empty: 265 last: 1	    empty: 0 last: 0	   empty: 10 last: 1     
empty: 0 last: 0	    empty: 0 last: 0	   empty: 130 last: 1    
empty: 217 last: 1	    empty: 3 last: 1	   empty: 0 last: 0      
empty: 0 last: 0	    empty: 0 last: 0	   empty: 86 last: 1     
empty: 139 last: 2	    empty: 0 last: 0	   empty: 0 last: 0      
empty: 76 last: 1	    empty: 221 last: 1	   empty: 26 last: 1     
empty: 0 last: 0	    empty: 1 last: 1	   empty: 0 last: 0      
empty: 0 last: 0	    empty: 0 last: 0	   empty: 0 last: 0      
empty: 0 last: 0	    empty: 0 last: 0	   empty: 12 last: 1     
empty: 103 last: 2	    empty: 0 last: 0	   empty: 71 last: 1     
empty: 69 last: 1	    empty: 0 last: 0	   
  • Tento jednoduchy model nepokryva vsetky faktory:
    • Segmenty nemaju rovnaku dlzku
    • Problemy v zostavovani kvoli chybam, opakovaniam a pod.
    • Segmenty nie su rozlozene rovnomerne (cloning bias a pod.)
    • Vplyv koncov chromozomov pri linearnych chromozomoch
    • Uzitocny ako hruby odhad
    • Na spresnenie mozeme skusat spravit zlozitejsie modely, alebo simulovat data
  • Poznamka: pravdepodobnosti z binomickeho rozdelenia mozeme lahko spocitat napr. statistickym softverom R. Tu su prikazy, ktore sa na to hodia, pre pripad, ze by vas to zaujimalo:
dbinom(10,1e4,0.001);  #(12.5% miest ma pokrytie presne 10)
pbinom(10,1e4,0.001,lower.tail=TRUE); #(58% miest ma pokrytie najviac 10)
dbinom(0:30,1e4,0.001); #tabulka pravdepodobnosti
 [1] 4.517335e-05 4.521856e-04 2.262965e-03 7.549258e-03 1.888637e-02
 [6] 3.779542e-02 6.302390e-02 9.007019e-02 1.126216e-01 1.251601e-01
[11] 1.251726e-01 1.137933e-01 9.481826e-02 7.292252e-02 5.207187e-02
[16] 3.470068e-02 2.167707e-02 1.274356e-02 7.074795e-03 3.720595e-03
[21] 1.858621e-03 8.841718e-04 4.014538e-04 1.743354e-04 7.254524e-05
[26] 2.897743e-05 1.112843e-05 4.115040e-06 1.467156e-06 5.050044e-07
[31] 1.680146e-07

Zhrnutie

  • Pravdedpobnostny model: myslienkovy experiment, v ktorom vystupuje nahoda, napr. hod idealizovanou kockou
  • Vysledok je hodnota, ktoru budeme volat nahodna premenna
  • Tabulka, ktora pre kazdu moznu hodnotu nahodnej premennej urci je pravdepodobnost sa vola rozdelenie pravdepodobnosti, sucet hodnot v tabulke je 1
  • Znacenie typu P(X=7)=0.1
  • Priklad: mame genom dlzky G=1mil., nahodne umiestnime N=10000 segmentov dlzky L=1000
  • Nahodna premenna X_i je pocet segmentov pokryvajucich urcitu poziciu i
  • Podobne, ako keby sme N krat hodili kocku, ktora ma cca 1 promile sancu padnu ako hlava a 99.9% ako znak a pytame sa, kolko krat padne znak (1 promile sme dostali po zaukruhleni z L/(G-L+1))
  • Rozdelenie pravdepobnosti sa v tomto pripade vola binomicke a existuje vzorec, ako ho spocitat
  • Takyto model nam moze pomoct urcit, kolko segmentov potrebujeme osekvenovat, aby napr. aspon 95% pozicii bolo pokrytych aspon 4 segmentami

Dynamické programovanie a UCSC genome browser, cvičenia pre biológov

Dynamické programovanie

  • Tuto techniku uvidime na dalsej prednaske na hladanie zarovnani (alignmentov)
  • Uvazujme problem rozmienania minci
  • Napr mame mince hodnoty 1,2,5 centov, z kazdej dostatok kusov
  • Ako mozeme zaplatit urcitu sumu, napr. 13 centov, s co najmensim poctom minci?
  • Ake je riesenie? 5+5+2+1 (4 mince)
  • Vseobecna formulacia:
    • Vstup: hodnoty k minci m_1,m_2,...,m_k a cielova suma X (vsetko kladne cele cisla)
    • Vystup: najmensi pocet minci, ktore potrebujeme na zaplatenie X
  • V nasom priklade k=3, m_1 = 1, m_2 = 2, m_3 = 5, X=13
  • Jednoduchy sposob riesenia: pouzi najvacsiu mincu, ktora je najviac X, odcitaj od X, opakuj
  • Priklad: najpr pouzijeme mincu 5, zostane name X=8, pouzijeme opat mincu 5, zostane X=3, pouzijeme mincu 2, zostane X=1, pouzijeme mincu 1.
  • Nefunguje vzdy: zoberme mince hodnot 1,3,4. Pre X=6 najlepsie riesenie je 2 mince: 3+3, ale nas postup (algoritmus) najde 3 mince 4+1+1
  • Ukazeme si algoritmus na zaklade dyn. programovania, ktory pre kazdy vstup najde najlepsie riesenie
  • Zratame najlepsi pocet minci nielen pre X, ale pre vsetky mozne cielove sumy 1,2,3,...,X-1,X
  • To zda byt ako tazsia uloha, ale ukaze sa, ze z riesenia pre mensie sumy vieme zostavit riesenie pre vacsie sumy, takze nam to vlastne pomoze
  • Spravime si tabulku, kde si pre kazdu sumu i=0,1,2,...X pamatame A[i]=najmensi pocet minci, ktore treba na vyplatenie sumy i (ak je viac moznosti, zoberieme lubovolnu, napr. najvacsiu)
  • Ukazme si to na priklade s mincami 1,3,4
i      0    1    2    3    4    5    6    7    8    9  
A[i]   0    1    2    1    1    2    2    2    2    3
  • Nevyplnali sme ju ziadnym konkretnym postupom, nejde o algoritmus
  • Ale predstavme si, ze teraz chceme vyplnit A[10].
  • V najlepsom rieseni je prva minca, ktoru pouzijeme 1,3, alebo 4
  • ak je prva minca 1, zostane name zaplatit sumu 10-1=9, tu podla tabulky vieme najlepsie zaplatit na 3 mince, takze potrebujeme 4 mince na zaplatenie 10
  • ak je prva minca 3, zostane nam zaplatit 10-3 = 7, na co potrebujeme podla tabulky 2 mince, takze spolu 3 mince na zaplatenie 10
  • ak je prva minca 4, zostanem nam zaplatit 10-4 = 6, na co treba 2 mince, t.j. 3 mince na 10
  • Nevieme, ktora z tychto moznosti je naozaj v najlepsom rieseni, ale pre druhe dva pripady dostaveme menej minci, takze vysledok budu 3 mince (napr. 3+3+4)
  • Zovseobecnime: A[i] = 1+ min { A[i-1], A[i-3], A[i-4] }
  • A[11] = 1 + min { 3, 2, 2} = 1 + 2 = 3
  • Pre sustavu minci 1,2,5, mame A[i] = 1+ min { A[i-1], A[i-2], A[i-5] }
  • Vo vseobecnosti A[i] = 1+ min { A[i-m_1], A[i-m_2], ..., A[i-m_k] }
  • Vzorec treba modifikovat pre male hodnoty i, ktore su mensie ako najvacsia minca, lebo A[-1] a pod. nie je definovane
  • Zapisme algoritmus pre vseobecne mince
A[0] = 0;
pre kazde i od 1 po X  
  min = nekonecno
  pre kazde j od 1 po k
     ak i >= m_j a A[i-m_j] < min
       min = A[i-m_j]
  A[i] = 1 + min
vypis A[X]
  • Ako najst, ktore mince pouzit?
  • Pridame druhu tabulku B, kde v B[i] si pamatame, ktora bola najlepsia prva minca, ked sme pocitali A[i]
i      0    1    2    3    4    5    6    7    8    9   10   
A[i]   0    1    2    1    1    2    2    2    2    3    3
B[i]   -    1    1    3    4    4    3    4    4    4    4
  • Potom ak chceme najst napr. mince pre 10, vidime, ze prva bola B[10]=4. Zvysok je 6 a prva minca na vyplatenie 6 je B[6]=3. Zostava nam 3 a B[3]=3. Potom nam uz zostava 0, takze sme hotovi. Takze najlepsie vyplatenie je 4+3+3
  • Algoritmus:
Kym X>0 
  vypis B[X];
  X = X-B[X];
  • Dynamicke programovanie vo vseobecnosti
    • Okrem riesenia celeho problemu, vyriesime aj spustu mensich podproblemov
    • Riesenia podproblemov ukladame do tabulky
    • Pri rieseni vacsieho podproblemu pouzivame uz vypocitane hodnoty pre mensie podproblemy
  • Aka je casova zlozitost?
    • Dva parametre: X a k.
    • Tabulka velkost O(X), kazde policko cas O(k). Celkovo O(Xk).

Používanie počítačov na M218

  • V textovom menu pri štarte zvoľte Linux, v prihlasovacom menu zadajte užívatela bioinf, heslo dostanete
  • Na dolnom okraji obrazovky je lišta s často používanými nástrojmi, napr. internetový prehliadač Firefox
  • Vo Firefoxe si otvorte stranku predmetu http://compbio.fmph.uniba.sk/vyuka/mbi/ cast Prednášky a poznámky, nalistujte materialy k dnesnemu cviceniu

UCSC genome browser

  • On-line grafický nástroj na prezeranie genómov
  • Konfigurovateľný, veľa možností, ale pomerne málo organizmov
  • V programe Firefox choďte na stránku UCSC genome browser http://genome.ucsc.edu/
  • Hore v modrom menu zvoľte Genomes, potom zvoľte ľudský genóm. Do okienka search term zadajte HOXA2. Vo výsledkoch hľadania (UCSC genes) zvoľte gén homeobox A2.
    • Pozrime si spolu túto stránku
    • V hornej časti sú ovládacie prvky na pohyb vľavo, vpravo, približovanie, vzďalovanie
    • Pod tým schéma chromozómu, červeným vyznačený zobrazená oblasť
    • Podtým obrázok vybranej oblasti, rôzne tracky
    • Podtým zoznam všetkých trackov, dajú sa zapínať, vypínať a konfigurovať
    • Po kliknutí na obrázok sa často zobrazí ďalšia informácia o danom géne alebo inom zdroji dát
    • V génoch exony hrubé, UTR tenšie, intróny vodorovné čiary
  • Koľko má HOXA2 exónov? Na ktorom chromozóme a pozícii je? Pozor, je na opačnom vlákne. Ako je táto skutočnosť naznačená na obrázku?
  • V tracku UCSC Genes kliknite na gén, mali by ste sa dostať na stránku popisujúcu jeho rôzne vlastnosti. Čo ste sa dozvedeli o jeho funkcii?
    • Na tejto stránke nájdite linku na stiahnutie proteínovej sekvencie. Aké sú prvé štyri aminokyseliny?

Sekvenovanie v UCSC genome browseri

  • Vráťte sa na UCSC genome browser http://genome.ucsc.edu/
  • Pozrieme si niekoľko vecí týkajúcich sa sekvenovania a skladania genómov
  • Hore v modrom menu zvoľte Genomes
  • Na ďalšej stránke zvoľte človeka a v menu Assembly zistite, kedy boli pridané posledné dve verzie ľudského genómu (hg18 a hg19)
  • Na tej istej stránke dole nájdete stručný popis zvolenej verzie genómu. Pre ktoré oblasti genómu máme v hg19 viacero alternatívnych verzií?
  • Zadajte región chr21:31,200,000-31,350,000
  • Zapnite si tracky Mapability a RepeatMasker na "full"
  • Mapability: nakoľko sa daný úsek opakuje v genóme a či teda vieme jednoznačne jeho ready namapovať pri použití Next generation sequencing
  • Ako a prečo sa pri rôznych dĺžkach readov líšia? (Keď kliknete na linku "Mapability", môžete si prečítať bližšie detaily.)
  • Približne v strede zobrazeného regiónu je pokles mapovateľnosti. Akému typu opakovania zodpovedá? (pozrite track RepeatMasker)
  • Zapnite si tracky "Assembly" a "Gaps" a pozrite si región chr2:110,000,000-110,300,000. Aká dlhá je neosekvenovaná medzera (gap) v strede tohto regiónu? Približnú veľkosť môžete odčítať z obrázku, presnejší údaj zistíte kliknutím na čierny obdĺžnik zodpovedajúci tejto medzere (úplne presnú dĺžku aj tak nepoznáme, nakoľko nie je osekvenovaná).
  • Prejdite na genóm Rhesus, verzia rheMac2, región chr7:59,022,000-59,024,000, zapnite si tracky Contigs, Gaps, Quality scores
  • Aké typy problémov v kvalite sekvencie v tomto regióne vidíte?

Zarovnávanie sekvencií, cvičenia pre informatikov

Opakovanie dynamického programovania pre globálne zarovnanie

Uvažujme napríklad skórovanie zhoda +1, nezhoda -1, medzera -1 a vstupné sekvencie X=x_{1}\dots x_{m} a Y=y_{1}\dots y_{n}. Nech s(x,y) je skóre písmen x a y, t.j. 1 ak sa zhodujú a -1 ak nie. Máme rekurenciu:

A[i,j]=\max \left\{A[i-1,j-1]+s(x_{i},y_{j}),A[i-1,j]-1,A[i,j-1]\right\}
  • Ako presne by sme implementovsali?
  • Ako spocitame maticu spatnych sipok B?
  • Akak je casova a pamatova zlozitost?

Reprezentácia pomocou grafu

Takéto dynamické programovanie vieme reprezentovať vo forme acyklického orientovaného grafu:

  • vrchol (i,j) pre každé 0\leq i\leq m,0\leq j\leq m, t.j. pre každé políčko dyn. prog. tabuľky
  • hrana z (i-1,j-1) do (i,j) s cenou s(x_{i},y_{j})
  • hrana z (i-1,j) do (i,j) s cenou -1
  • hrana z (i,j-1) do (i,j) s cenou -1
  • súčet súradníc na každej hrane rastie, graf teda nemôže obsahovať cyklus, je acyklický
  • každá cesta z (0,0) do (m,n) zodpovedá zarovnaniu, jej cena je cenou zarovnania (každá hrana jeden stĺpec)
  • optimálne zarovnanie teda zodpovedá ceste s maximálnou cenou

Krátka vsuvka o acyklických orientovaných grafoch

  • Mame dany acyklicky orientovany graf s ohodnotenymi hranami a startovaci vrchol s, koncovi vrchol t a chceme najst cestu s max. cenou z s do t.
  • Hladanie cesty s maximalnou cenou je vo vseobecnosti NP-tazke (podobne na Hamiltonovsku cestu)
  • V acyklickom grafe to vsak vieme riesit efektivne
  • Najskor si graf zotriedime topologicky, t.j. usporiadame vrcholy tak, aby kazda hrana isla z vrcholu z mensim cislom do vrcholu s vacsim cislom. To sa da modifikaciou prehladavania do hlbky v case O(|V|+|E|)
  • Potom pocitame dynamickym programovanim, kde A[u] je dlzka najdlhsej cesty z s do u: A[u]=\max _{{v:v\rightarrow u\in E}}A[v]+c(v\rightarrow u)

pricom na zaciatku nastavime A[s]=0 a na konci mame cenu cesty v A[t].

  • Cas vypoctu je O(|V|+|E|)
  • Vsimnime si, ze tiez dostaneme najdlhsie cesty z s do vsetkych vrcholov.

Ak tento algoritmus nasadime na graf pre globalne zarovnanie, dostavame presne nasu rekurenciu (topologicke triedenie mozno vynechat - poradie zhora dole a zlava doprava je topologicky utriedene). Vyhoda je, ze mozeme modifikaciou grafu ziskavat riesenia roznych pribuznych problemov bez toho, aby sme vzdy vymyslali novu rekurenciu.

Lokalne zarovnanie

  • Zarovnanie moze zacat a skoncit hocikde v matici
  • Pridaj startovaci vrchol s, koncovy vrchol t
  • Pridaj hrany s->(i,j) a (i,j)->t s cenou 0 pre kazde (i,j)
  • Opat ekvivalentne s rekurenciou z prednasky

Variant: chceme zarovnat cely retazec X k nejake casti retazca Y (napr. mapovanie sekvenovacich readov na genom)

  • Iba zmenime hrany z s a hrany do t (ako?)

Afinne skore medzier

  • Napr. otvorenie medzery -2, pokracovanie medzery -1

A - - - T C G A C G C T C C 1 -2 -1 -1 1 1 -1

Riesenie 1:

  • Pridame hrany pre cele suvisle useky medzier so spravnou cenou
  • (i,j)->(i,k) s cenou o+(k-j)e
  • (i,j)->(k,j) s cenou o+(k-i)e
  • Cas O(mn(m+n)), t.j. kubicky
  • pozor, mame aj cesty, ktore nezopodvedaju ziadnemu spravnemu skore, napr. (i.j)->(i+1,j)->(i+2,j) ma cenou 2o, ale ma mat o+e. Nastastie hrana (i,j)->(i+2,j) ma vyssiu cenu, takze ta dlhsia cesta sa nepouzije.

Riesenie 2:

  • ztrojnasobime kazdy vrchol (i,j)_{u},(i,j)_{v},(i,j)_{z}
  • v indexe si pamatame, odkial sme do (i,j) prisli (u=uhlopriecne, v=vodorovne, z=zvislo)
  • ak ideme napr. z (i,j-1)_{v} do (i,j)_{v}, pokracujeme v uz existujucej medzere, takze skore je e
  • ak ideme napr. z (i,j-1)_{u} do (i,j)_{v}, zaciname novu medzeru, takze skore je o
  • ake vsetky hrany teda mozeme mat? Kolko je spolu v grafe hran a vrcholov a aka je zlozitost algoritmu?

Linearna pamat: Hirshbergov algoritmus 1975

  • Klasicke dynamicke programovanie potrebuje cas O(nm)
  • Trivialna implementacia tiez pouzije pamat O(mn) - uklada si celu maticu A, pripadne maticu B so sipkami naspat
  • Na vypocet matice A nam z stacia dva riadky tejto matice: riadok i pocitam len pomocou riadku i-1, starsie viem zahodit
  • Ale ak chcem aj vy[isat zarovnanie, stale potrebujem pamat O(mn) na maticu sipok B
  • Hirschbergov algoritmus znizi pamat na O(m+n), zhruba zdvojnasobi cas (stale O(mn))
  • Prejdeme celú maticu a spočítame maticu A. Zapamätáme si, kde moja cesta prejde cez stredný riadok matice
    • Nech B_k[i,j] je najväčší index v riadku k, cez ktorý prechádza najkratšia cesta z (0,0) do (i,j)
  • Ako vieme B_k[i,j] spočítať?
    • ak A[i,j] = A[i-1,j-1]+w(S[i],T[j])$, potom B_k[i,j]=B_k[i-1,j-1].
    • ak A[i,j]=A[i-1,j]+1, potom B_k[i,j]=B_k[i-1,j].
    • ak A[i,j]=A[i,j-1]+1, potom B_k[i,j]=B_k[i,j-1]
    • Toto platí, ak i > k. Pre i=k nastavíme B_k[i,j]=j
  • Ak už poznáme A[i-1,*] a B_k[i-1,*], vieme spočítať A[i,*] a B_k[i,*].
    • Stacia nam teda iba dva riadky matice A a B_k
  • Nech k'=B_k[m,n]. Potom v optimálnom zarovnaní sa S[1..k] zarovná s T[1..k'] a S[k+1..m] s T[k'+1..n].
    • Toto použijeme na rekurzívny algoritmus na výpočet zarovnania:
optA(l1, r1, l2, r2) { // align S[l1..r1] and T[l2..r2]
    if(r1-l1 <= 1 ||  r2-l2 <=1) 
        solve using dynamic programming
    else {
        k=(r-l+1)/2;
        for (i=0; i<=k; i++) 
           compute A[i,*] from A[i-1,*]
        for (i=k+1; i<=r-l+1; i++) 
           compute A[i,*], B_k[i,*] from A[i-1,*], B_k[i-1,*]
        k2=B_k[r1-l1-1,r2-l2-1];
        optA(l1, l1+k-1, l2, l2+k2-1); 
        optA(l1+k, r2, l2+k2, r2); 
    }
}

Casova zlozitost:

  • Označme si N=nm (súčin dĺžky dvoch daných reťazcov).
  • Na hornej úrovni rekurzie spúšťame dynamické programovanie pre celú maticu -- čas bude $cN$.
  • Na druhej urovni mame dva podproblemy, velkosti N1 a N2, pricom N1+N2<=0.5*N (z kazdeho stlpca matice A najviac polovica riadkov pocitana znova)
  • Na tretej urovni mame 4 podproblemy N11, N12, N21, N22, pricom N11+N12 <= 0.5*N1 a N21+N22 <= 0.5*N2 a teda celkovy sucet podproblemov na druhej urvni je najviac N/4.

Na stvrtej urovni je sucet podproblemov najviac N/8 atd, Dostavame geometricky rad cN+cn/2+cN/4+... ktoreho sucet je 2cN

Vypisanie vsetkych najlepsich rieseni

  • Namiesto jednej spatnej sipky si pamatame vsetky, ktore v danom A[i,j] viedli k maximalnej cene
  • Potom mozeme rekurzivne prehladavat a vypisovat vsetky cesty z (m,n) do (0,0) ktore pozostavaju iba zo zapamatanych hran
  • Cas na vypisanie jednej cesty je polynomialny, ale ciest moze byt exponencialne vela!
  • Mozno namiesto toho chceme len pocet takych ciest, alebo vsetky dvojice pismen, ktore mozu byt spolu zarovnane v niektorom optimalnom zarovnani

Zarovnávanie sekvencií, cvičenia pre biológov

Zarovnávanie sekvencií, opakovanie

  • Uvazujme skorovanie zhoda +2, nezhoda -1, medzera -1
  • Retazce TAACGG a CACACT

Globalne zarovnanie

  • Rekurencia: A[i,j] = max {A[i-1,j]-1, A[i,j-1]-1, A[i-1,j-1]+s(x_i, y_j) }, pricom A[0,i]=-i, A[i,0]=-i
        C   A   C   A   C   T
    0  -1  -2  -3  -4  -5  -6
T  -1  
A  -2  
A  -3  
C  -4  
G  -5  
G  -6  

Lokalne zarovnanie

  • Rekurencia: A[i,j] = max {0, A[i-1,j]-1, A[i,j-1]-1, A[i-1,j-1]+s(x_i, y_j) }, pricom A[0,i]=0, A[i,0]=0
        C   A   C   A   C   T
    0   0   0   0   0   0   0
T   0 
A   0 
A   0 
C   0 
G   0 
G   0 

Príklad s mincami v Exceli

Práca so vzorcami v tabuľkovom procesore (Excel, OpenOffice, ...)

  • Okrem konkrétnych hodnôt, napr. 0.3, môžu byť aj vzorce, ktoré začínajú =, napr =0.3*0.3 dá do políčka 0.09 (* znamená násobenie)
  • Vo vzorcoch môžeme používať aj hodnoty z iných políčok, napr. =A2+B2 dáme do políčka C2, zobrazí sa tam súčet
  • Ak políčko so vzorcom skopírujeme do iného políčka, Excel sa snaží uhádnuť, ako zmeniť vzorec
    • Ak sme v C2 mali =A2+B2 a skopírovali sme to do C3, vzorec sa zmení na =A3+B3
  • Ak niektoré adresy políčok majú zostávať rovnaké aj pri kopírovaní, dáme pred písmeno aj číslo $,
    • Ak v C2 máme =A2+$B$2 a skopírujeme to do C3, dostaneme =A3+B2
  • Dolár možeme dať aj pred iba jednu súradnicu (stĺpec alebo riadok), tá sa potom nebude pri kopírovaní meniť

Späť k minciam

  • vratme sa k prikladu s rozmienanim minci a skusme si ho "naprogramovat" v Exceli, resp. spreadsheet aplikacii v OpenOffice
  • Vseobecna formulacia:
    • Vstup: hodnoty k minci m_1,m_2,...,m_k a cielova suma X (vsetko kladne cele cisla)
    • Vystup: najmensi pocet minci, ktore potrebujeme na zaplatenie X
  • My pouzijeme mince hodnot 1,3,4
  • Spravime si tabulku, kde si pre kazdu sumu i=0,1,2,...X pamatame A[i]=najmensi pocet minci, ktore treba na vyplatenie sumy i (ak je viac moznosti, zoberieme lubovolnu, napr. najvacsiu)
i      0    1    2    3    4    5    6    7    8    9  
A[i]   0    1    2    1    1    2    2    2    2    3
  • vzorec A[i] = 1+ min { A[i-1], A[i-3], A[i-4] }
  • aby sme nemuseli zvlast uvazovat hodnoty mensie ako 4, (kde sa neda A[i-4]), urcime si A[-1], A[-2] atd ako nejake velke cislo (napr 100), takze vzorec plati pre vsetky i>0
i      -4  -3  -2  -1  0    1    2    3    4    5    6    7    8    9  
A[i]  100 100 100 100  0    1    2    1    1    2    2    2    2    3
  • v exceli si najskor spravime horny riadok tabulky
    • do nejakeho policka (napr, B4) zapiseme prvu hodnotu (-4)
    • do susedneho C4 zapiseme vzorec =B4+1, dostaneme hodnotu -3
      • vzorce zacinaju znamienkom =
      • B4 je suradnica policka o jedno vlavo, k nedj pripocitame 1
    • policko C4 nakopirujeme do riadku kolkokrat chceme, dostaneme hodnoty -2, -1, 0, 1,...
      • kopirovat sa da tahanim laveho dolneho rohu okienka
      • vzorec sa automaticky posuva na =C4+1, =D4+1, atd
    • o riadok nizsie do B5..E5 napiseme hodnotu 100 (okienka A[-4]..A[-1])
    • do F5 dame 0 (okienko A[0] nasej tabulky)
    • do G5 napiseme vzorec =MIN(F5,D5,C5)+1 (t.j. A[1] = min(A[1-1],A[1-3],A[1-4])+1)
    • tento vzorec potom nakopirujeme do riadku tabulky
    • F5 sa bude posuvat na G5, H5,... a podobne ostatne dva cleny

Cvičenie:

  • Ako by sme zmenili na inu mincovu sustavu, napr. 1,2,5?
  • Stiahnite si subor zo stranky predmetu a skuste si tuto zmenu urobit [1]

Zarovnávanie sekvencií v Exceli

  • skusme si aj dynamicke programovanie naprogramovat v Exceli
  • budeme postupovat podobne, ale potrebujeme dve specialne funkcie: MID(text,od,dlzka) z textu vyberie urcitu cast. Pomocou toho si vstupny text rozdelime na jednotlive pismena, ktore si napiseme do zahlavia tabulky
  • vsimnite si pouzivanie dolarov v nazvoch policok: ak je pred menom stlpca alebo riadku $, tento sa neposuva ked vzorec kopirujem do inych policok
  • IF(podmienka,hodnota1,hodnota2) vyberie bud hodnotu 1 ak je podmienka splnena alebo hodnotu2 ak nie je. Napr IF(F$8=$B12 ,1,-1) zvoli skore +1 ak sa hodnota v F8 rovna hodnote v B12 a skore -1 ak sa nerovnaju.

Cvicenie: Zmente tabulku tak, aby skore pre zhody, nezhody a medzery bolo dane bunkami B1, B2 a B3 tabulky. Staci zmenit vzorce a policka D9, C10 a D10 a nakopirovat do zvysku tabulky. Ake bude skore najlepsieho zarovnania sekvencii AACGTA a ACACCTA ak skore nezhody je -2 a medzery -3?

Dotploty

  • Dotplot je graf, ktory ma na kazdej osi jednu sekvenciu a ciarky zobrazuju lokalne zarovnania (cesty v matici)
  • Na slidoch mame niekolko prikladov dotplotov porovnavajucich rozne mitochondrialne genomy
  • Tieto boli vytvorene pomocou nastroja YASS http://bioinfo.lifl.fr/yass/yass.php
  • Dalsi priklad je zarovnanie genu Oaz Drosophila zinc finger s genomickym usekom chr2R:10,346,241-10,352,965
  • Trochu iny dotplot, ktory funguje pre proteiny a nerobi lokalne zarovnania, iba spocita skore bez medzier v kazdom okne danej vysky a nakresli ciaru ak pre kroci urcenu hodnotu
  • http://emboss.bioinformatics.nl/cgi-bin/emboss/dotmatcher
  • Vyskusame protein escargot voci sebe s hodnotami http://pfam.sanger.ac.uk/protein/ESCA_DROME window 8 threshold 24
  • Pomocou YASSu vyskusame kluster zhlukov PRAME z ludskeho genomu
  • Obrázky dotplotov na slidoch

Prakticke cvicenie: Yass a dotploty

  • Prelozili sme na neskorsie cvicenie
  • Na stranke UCSC genome browseru http://genome.ucsc.edu/ si zadajte ludsky genom, najnovsiu verziu (hg19)
  • V druhom okne/tabe si otvorte YASS server na adrese http://bioinfo.lifl.fr/yass/yass.php
  • V genome browseri zadajte region chr21:10,018,860-10,019,178
    • tento región obsahuje Alu repeat. Tieto opakovania tvoria cca 10% ľudského genómu, viac ako milión kópií
    • zobrazte si DNA sekvenciu tohto useku takto: na hornej modrej liste zvolte View, potom v podmenu DNA, na dalsej obrazovke tlacidlo get DNA
  • DNA sekvenciu Alu opakovania chceme zarovnat samu k sebe programom YASS
    • DNA sekvenciu Alu opakovania skopirujte do okienka "Paste your sequences" v stranke Yass-u a dvakrat stlacte tlacidlo Select vedla okienka
    • Nizsie v casti "Selected DNA sequence(s)" by sa Vam malo v oboch riadkoch objavit "Pasted file 1"
    • Nizsie v casti "Parameters" zvolte "E-value threshold" 0.01 a stlacte "Run YASS"
    • Vo vysledkoch si pozrite Dotplot, co z neho viete usudit o podobnosti jednotlivych casti Alu opakovania?
    • Vo vysledkoch si pozrite Raw: blast, ake su suradnice opakujucej sa casti a kolko zarovnanie obsahuje zhod/nezhod/medzier? (Pozor, prve zarovnanie je cela sekvencia sama k sebe, druhe je asi to, co chcete)
  • V genome browseri zadajte poziciu chr21:9,440,000-9,450,000 (10kb sekvencie na chromozome 21, s niekolkymi vyskytmi Alu)
  • Chceme teraz porovnat tento usek genomu so sekvenciou Alu pomocou YASSu
    • Ako predtym si stiahnite DNA sekvenciu tohto useku
    • V YASSe chodte sipkou spat na formular
    • Skopirujte DNA sekvenciu do YASSoveho formulara, do okienka vpravo (vyznacit si ju mozete klavesovou kombinaciou Ctrl-A alebo Select All v menu Edit),
    • V casti formulara Selected DNA sequence(s) stlacte Remove pri hornom riadku
    • Pri pravom okienku, kam ste nakopirovali sekvenciu, stlacte Select
    • Zase stlacte Run YASS
    • Pozrite si vysledok ako Dotplot, kolko opakovani Alu ste nasli? Preco je jedno cervene?
    • Pozrite si Raw: blast, na kolko percent sa podoba najpodobnejsia a na kolko druha najpodobnejsia kopia?

Zarovnávanie sekvencií 2, cvičenia pre informatikov

  • Cvicenia pre informatikov z jadier s medzerami (spaced seeds)
  • Prva cast na slidoch

Vzorec na vypocet senzitivity jadra bez medzier

  • Uvazujme jadro bez medzier dlzky w (ako v programe BLAST pre nukleotidy)
  • Uvazujme pravdepodobnostny model zarovnania, v ktorom ma kazda pozicia pravdepodobnost p, ze bude zhoda a (1-p), ze bude nezhoda, medzery neuvazujeme.
  • Nech f(L) je pravdepodobnost vyskytu jadra v zarovnani dlzky L, t.j. pravdepodobnost w za sebou iducich zhod.
  • f(L)=\left\{{\begin{array}{ll}0&{\mbox{ak }}L<w\\p^{w}+\sum _{{i=0}}^{{w-1}}p^{i}(1-p)f(L-i-1)&{\mbox{ak }}L\geq w\\\end{array}}\right.

Vektorove jadra

  • zarovnanie ako postupnost skore (napr 0/1 pre zhoda/nezhoda, male cele cisla pre BLOSUM63 maticu skorovania aminokyselin)
  • Jadro je vektor vah v_q\dots v_k dlzky k a prahova hodnota T
  • Okno zarovnania s_1\dots d_k je vyskyt jadra ak \sum _{{i=1}}^{k}s_{i}v_{i}\geq T
  • Vyjadrite jadra s medzerami, BLAT-ove a BLASTp jadra ako vektorove jadra

Rychle hladanie jadier v sekvenciach

  • Jadro bez medzier (BLAST)
    • trivialna hash tabulka velkost 4^w
    • Aho-Corasickovej algoritmus pre vsetky w-tice v prvom retazci
    • sufixovy strom
    • atd
  • Jadro s medzerami
    • Pouzijeme trivialnu hash tabulku, ale ukladame len znaky na neignorovanych poziciach
  • Jadro BLAT-u
    • Hash tabulka pre jednu sekvenciu, pre druhu hladame vsetky retazce v okoli danej k-tice ktore sa lisia najviac na jednom mieste (je ich 3k+1)
    • Ak by sme dovolili viac rozdielov, ich pocet by rychlo narastal

Senzitivita jadra s medzerami

  • Da sa rekurentny vzorec vyssie rozsirit na jadro s medzerami?
  • f(L)=\left\{{\begin{array}{ll}0&{\mbox{ak }}L<w\\p^{w}+\sum _{{i=0}}^{{w-1}}p^{i}(1-p)f(?)&{\mbox{ak }}L\geq w\\\end{array}}\right.
  • Co by sme pouzili namiesto otaznika?
  • Napr pre jadro 1011 a zaciatok zarovnania 1?10 moze byt vyskyt na pozicii 3, ale jeho pravdepodobnost nie je f(L-2), lebo mame dane prve dva znaky

Vseobecny algoritmus pre jadra s medzerami/vektorove jadra

  • Zial vo vseobecnosti exponencialny od dlzky jadra, ale pre male jadra sa da zbehnut v rozumnom case
  • Zarovnanie si predstavme ako nejaku postupnost nad abecedou D (napr D={Z,H} kde Z je zhoda, H nezhoda). Nech q_d je pravdepodobnost znaku d z D v zarovnani
  • Uvazujme jadro dlzky k, co si vieme predstavit ako nejake pravidlo, ktore urci, ci dany retazec dlzky k nad D je alebo nie je vyskytom jadra
  • H nech je mnozina vsetkych vyskytov jadra (t.j. mnozina retazcov x dlzky k nad mnozinou D, ktore splnaju podmienku jadra)
  • Nech f(L,x) je pravdepodobnost vyskytu jadra v zarovnani dlzky L, ktore zacina na retazec x, kde x je hocijaky retazec nad D dlzky najviac k
  • f(L,x)=\left\{{\begin{array}{ll}0&{\mbox{ak }}L<k\\1&{\mbox{ak }}L\geq k\wedge x\in H\\f(L-1,z)&{\mbox{ak }}L\geq k\wedge x\notin H\wedge |x|=k\wedge x=dz,d\in D\\\sum _{{d\in D}}q_{d}f(L,xd)&{\mbox{ak }}L\geq k\wedge |x|<k\\\end{array}}\right.
  • f(L,x) budeme pocitat pre rastuce L a pre kazde L od najdlhsich x.
  • vysledok je f(L,\varepsilon )


Rychlejsi algoritmus

  • Nech H_p je mnozina prefixov retazcov z H (mozne vyskyty) a H_g je mnozina prefixov retazcov z H, ktorych kazde rozsirenie na dlzku k je vyskyt (garantovane vyskyty)
  • H\subseteq H_{g}\subseteq H_{g}
  • Nech f(L,x) je pravdepodobnost vyskytu jadra v zarovnani dlzky L, ktore zacina na retazec x.
  • f(L,x)=\left\{{\begin{array}{ll}0&{\mbox{ak }}L<k\\1&{\mbox{ak }}L\geq k\wedge x\in H_{g}\\\sum _{{d\in D}}q_{d}f(L,xd)&{\mbox{ak }}L\geq k\wedge x\in H_{p}\setminus H_{g}\\f(L-|y|,z)&{\mbox{ak }}L\geq k\wedge x\notin H_{p}\wedge x=yz,z\in H_{P},z{\mbox{ najdlhsie mozne}}\\\end{array}}\right.
  • f(L,x) budeme pocitat pre rastuce L a pre kazde L od najdlhsich x. Staci uvazovat x z H_p alebo x, ktore dostaneme pridanim jedneho znaku k slovu z H_p.
  • vysledok je f(L,\varepsilon )
  • Pre jadro s g medzerami |H|=2^{g} a |H_{p}|\leq k2^{g}.

Počítanie fylogenetických stromov

  • Ako definujeme strom v teorii grafov? suvisly acyklicky neorientovany graf
  • Strom s n vrcholmi ma n-1 hran
  • Nezakoreneny binarny fylogeneticky strom: neorientovany suvisly acyklicky graf, v listoch sucasne druhy, vsetky vnutorne vrcholy stupna 3
  • Zakoreneny binarny fylogeneticky strom: vsetky hrany orientujeme od korena smerom k listom, kazdy vnutorny vrchol ma dve deti
  • Niekedy uvazujeme aj nebinarne stromy, v ktorych mame vnutorne vrcholy vyssieho stupna
  • Zakoreneny binarny strom s n listami ma n-1 vnutornych vrcholov, teda 2n-2 hran
  • Nezakoreneny binarny strom s n listami ma n-2 vnutornych vrcholov, teda 2n-3 hran
  • Pocet nezakorenenych fylogenetickych stromov s n listami:
    • a(3) = 1, a(4) = 3, a(n+1) = a(n) * (2n-3) a teda a(n) = 1 * 3 * 5 * ... * (2n-5) = (2n-5)!!
  • Pocet zakorenenych fylogenetickych stromov s n listami:
    • zakoren strom s n listami kazdy 2n-3 sposobmi, teda (2n-3)!!

Úvod do pravdepodobnosti, cvičenia pre biológov

Uvod do pravdepodobnosti

  • Myslienkovy experiment, v ktorom vystupuje nahoda, napr. hod idealnou kockou/korunou
  • Vysledkom experimentu je nejaka hodnota (napr. cislo, alebo aj niekolko cisel, retazec)
  • Tuto neznamu hodnotu budeme volat nahodna premenna
  • Zaujima nas pravdepodobnost, s akou nahodna premenna nadobuda jednotlive mozne hodnoty
  • T.j. ak experiment opakujeme vela krat, ako casto uvidime nejaky vysledok
  • Priklad 1: hodime idealizovanou kockou, premenna X bude hodnota, ktoru dostaneme
  • Mozne hodnoty 1,2,..,6, kazda rovnako pravdepodobna
  • Piseme napr. Pr(X=2)=1/6
  • Priklad 2: hodime 2x kockou, nahodna premenna X bude sucet hodnot, ktore dostaneme
  • Mozne hodnoty: 2,3,...,12
  • Kazda dvojica hodnot na kocke rovnako pravdepodobna, t.j. pr. 1/36
  • Sucet 5 mozeme dostat 1+4,2+3,3+2,4+1 - t.j. P(X=5) = 4/36
  • Sucet 11 mozeme dostat 5+6 alebo 6+5, t.j. P(X=11) = 2/36
  • Rozdelenie pravdepodobnosti: (tabulka udavajuca pravdepodobnost pre kazdu moznu hodnotu)
hodnota i:   2     3     4     5     6     7     8     9     10    11    12
Pr(X=i):    1/36  2/36  3/36  4/36  5/36  6/36  5/36  4/36  3/36  2/36  1/36
  • Overte, ze sucet pravdepodobnosti je 1
  • Stredna hodnota E(X):
    • priemer z moznych hodnot vahovanych ich pravdepodobnostami
    • v nasom priklade E(X)=2\cdot {\frac  {1}{36}}+3\cdot {\frac  {2}{36}}+4\cdot {\frac  {3}{36}}+5\cdot {\frac  {4}{36}}+6\cdot {\frac  {5}{36}}+7\cdot {\frac  {6}{36}}+8\cdot {\frac  {5}{36}}+9\cdot {\frac  {4}{36}}+10\cdot {\frac  {3}{36}}+11\cdot {\frac  {2}{36}}+12\cdot {\frac  {1}{36}}=7
  • Ak by sme experiment opakovali vela krat a zratali priemer hodnot X, ktore nam vysli, dostali by sme cislo blizke E(X)
  • Iny vypocet strednej hodnoty:
    • X=X1+X2, kde X1 je hodnota na prvej kocke a X2 je hodnota na druhej kocke
    • E(X_{1})=1\cdot {\frac  {1}{6}}+...+6\cdot {\frac  {1}{6}}=3.5, podobne aj E(X2) = 3.5
    • Plati, ze E(X1+X2)=E(X1) + E(X2) a teda E(X) = 3.5 + 3.5 = 7
    • Pozor, pre sucin a ine funkcie taketo vztahy platit nemusia, napr. E(X_{1}\cdot X_{2}) nie je vzdy E(X_{1})\cdot E(X_{2})

Pravdepodobnostny model nahodnej sekvencie

  • Napriklad chceme modelovat nahodnu DNA sekvenciu dlzky n s obsahom GC 40%
  • Mame vrece s gulockami oznacenyni A,C,G,T, pricom gulocok oznacenych A je 30%, C 20%, G 20% a T 30%.
  • Vytiahneme gulicku, zapiseme si pismeno, hodime ju naspat, zamiesame a opakujeme s dalsim pismenom atd, az kym nevygenerujeme n pismen
  • Vytiahnime z mechu 2x gulicku. Prve pismeno, ktore nam vyjde, oznacme X1 a druhe X2
  • Pr(X1=A) = 0.3, Pr(X2=C)=0.2
  • Pr(X1=A a X2=C) = Pr(X1=A)*Pr(X2=C) = 0.3*0.2 = 0.06
    • T.j. sanca ze dostaneme sekvenciu AC po dvoch tahaniach je 6%
    • Ak ratame pravdepodobnost, ze sa dve nezavisle udalosti stanu, ich pravdepodobnosti nasobime. V tomto pripade to ci X1=A je nezavisle od toho, ci X2=C
  • Pr(X1 je A alebo G) = Pr(X1=A)+Pr(X1=G) = 0.3+0.2 = 0.5
    • Pravdepodobnost ze prve pismeno bude A alebo G je 50%
    • Pravdepodobnosti navzajom sa vylucujucich udalosti (X1=A a X1=G) sa mozu scitat, cim dostaneme pravdepodobnost, ze aspon jedna z nich nastane
  • Pr(X1 je A alebo X2 je G) nemozeme pocitat ako Pr(X1=A)+Pr(X2=G), lebo sa navzajom nevylucuju a pripad ze X1=A a X2=G by sme zapocitali dvakrat
  • Spravne je Pr(X1 je A alebo X2 je G) = Pr(X1=A) + Pr(X1 <> A a X2=G) = Pr(X1=A) + Pr(X1 <> A) * Pr(X2=G) = 0.3+0.7*0.2 = 0.44
    • Podobne napr Pr(v sekvencii je aspon jedno A) = Pr(X1=A alebo X2=A) = Pr(X1=A) + Pr(X1 <> A a X2=A) = Pr(X1=A) + Pr(X1 <> A) * Pr(X2=A) 0.3+0.7*0.3 = 0.51
  • Pr(X1=X2) = Pr(X1=X2=A) + Pr(X1=X2=C) + Pr(X1=X2=G) + Pr(X1=X2=T) = 0.3*0.3+0.2*0.2+0.2*0.2+0.3*0.3 = 0.26.
  • Ak u označíme pravdepodobnost u = Pr(X1=A)=Pr(X1=T)=Pr(X2=A)=Pr(X2=T) a v=Pr(X1=C)=Pr(X1=G)=Pr(X2=C)=Pr(X2=G), aky bude vzorec na Pr(X1=X2)?

E-hodnota (E-value) zarovnania

  • Priklady k tejto casti v prezentacii [2]
  • Mame dotaz dlzky m, databazu dlzky n, skore najlepsieho lok. zarovnania S
  • E-value je ocakavany pocet zarovnani so skore aspon S ak dotaz aj databaza su nahodne
  • Hrackarsky priklad: dotaz dlzky m=4, databaza dlzky n=200, S=4, t.j. presny vyskyt dotazu v databaze (pre presne vyskyty sa pravdepodobnosti pocitaju ovela lahsie ako ked dovolime nezhody a medzery)
  • Zoberme nas nahodny model s obsahom GC 40%
  • Mame vrece s gulockami oznacenyni A,C,G,T, pricom gulocok oznacenych A je 30%, C 20%, G 20% a T 30%.
  • Vytiahneme gulicku, zapiseme si pismeno, hodime ju naspat, zamiesame a opakujeme s dalsim pismenom atd az kym nevygenerujeme m pismen pre dotaz a n pismen pre databazu
  • Pre nase vygenerovane sekvencie spocitame, kolkokrat sa dotaz vyskytuje v databaze
  • Cely experiment opakujeme vela krat a spocitame priemerny pocet vyskytov, co bude odhad E-value
  • Vieme spocitat aj presne:
  • Mame dotaz X1X2...Xm a databazu Y1Y2...Yn. Aka je sanca, ze X sa nachadza na zaciatku Y, t.j. ze X1=Y1, X2=2... Xm=Ym?
  • Pripominame, ze pravdepodobnost zhody dvoch nukelotidov napr X1 a Y1 je Pr(X1=Y1) = Pr(X1=Y1=A) + Pr(X1=Y1=C) + Pr(X1=Y1=G) + Pr(X1=Y1=T) = 0.3*0.3+0.2*0.2+0.2*0.2+0.3*0.3 = 0.26.
  • Pre rozne pozicie v X mame nezavisle udalosti, t.j. pravdepodobnost vyskytu X na prvej pozicii je Pr(X1=Y1)*Pr(X2=Y2)*...*Pr(Xm=Ym) = 0.26 * 0.26 * ... * 0.26 = 0.26^m (0.26 na m-tu)
  • Tak isto nam vyjde aj pravdepodobnost vyskytu X na hociktorej inej pevnej pozicii v Y
  • Pravdepodobnost, ze sa X nachadza na aspon jednej pozicii v Y (t.j. P-value zarovnania) je tazsie zratat - moze sa vyskytovat aj viackrat, udalosti ze sa nachadza na pozicii i sa navzajom nevylucuju
  • Ale priemerny pocet vyskytov na pozicii i je 0.26^m, mame n-m+1 pozicii zaciatku, takze celkovy ocakavany pocet vyskytov je (n-m+1)0.26^m
    • Toto je stredna hodnota nahodnej premennej C, ktora oznacuje pocet presnych vyskytov
    • E(C) = E(C_1)+E(C_2)+...E(C_(n-m+1)), kde C_i je nahodna premenna, ktora je 1 ak sa X nachadza na pozicii i v Y
    • E(C_i) = 0*Pr(C_i=0)+1*Pr(C_i=1) = Pr(C_i=1) = 0.26^m
  • Ak je n velke v porovnani s m, clen -m+1 mozeme zanedbat, t.j. mame zhruba n*0.26^m
  • Ako sa meni toto cislo s velkostou databazy n? linearne rastie (zdvojnasobime databazu, zdvojnasobi sa E-value)
  • Ako sa meni s m? Exponencialne klesa, t.j. ak predlzime dotaz o 1 (a stale dostaneme skore m), E-value klesne zhruba na stvrtinu
  • Ako sa meni s GC obsahom? Zakodovane v cisle 0.26 - vyskusame si pri pocitaci v tabuľkovom procesore

Cvicenie pri pocitaci

  • Stiahnite si subor [3], ulozte si ho a otvorte v openoffice
  • Do zlteho policka vyplnte vzorec na vypocet pravdepodobnosti zhody medzi dvoma nahodne vygenerovanymi nukleotidmi v zacislosti od %GC v stlpci A.
  • Vzorce v stlpcoch B-F nakopirujte do vsetkych riadkoch tabulky (napr dvojitym pokopanim na svtorcek v pravom dolnom roku okienka)
  • Ako sa meni E-value v zavislosti od GC (hodnoty v modrom stlpci F)? Preco je to tak? Mozete si nakreslit aj graf.
  • Potom skusajte menit hodnoty m a n a vsimnite si, ci maju taky vplyv na e-value, ako sme vraveli

Skorovacie matice

Chceme urcit skorovaciu schemu pre zarovnavanie dvoch DNA sekvencii (bez medzier). Mame dva modely, kazdy z nich vie vygenerovat 2 zarovnane sekvencie dlzky n.

Model R (random) reprezentuje nezavisle nahodne sekvencie

  • Opat pouzijeme nase vrece s gulockami oznacenyni A,C,G,T, pricom gulocok oznacenych A je 30%, C 20%, G 20% a T 30%.
  • Vytiahneme gulicku, zapiseme si pismeno, hodime ju naspat, zamiesame a opakujeme s dalsim pismenom atd az kym nevygenerujeme n pismen pre jednu sekvenciu a n pismen pre druhu
  • Mame jednu sekvenciu ACT a druhu ACC. Aka je sanca, ze prave tieto sekvencie vygenerujeme v nasom modeli R?
  • Nezavisle udalosti pre jednotlive pismena, t.j. Pr(X1=A)*Pr(X2=C)*Pr(X3=T)*Pr(Y1=A)*Pr(Y2=C)*Pr(Y3=C) = 0.3*0.2*0.3*0.3*0.2*0.2 = 0.000216
  • Spolu mame v modeli 4 na 6 = 4096 moznosti ako vygenerovat 2 sekvencie dlzky 3

Model H (homolog) reprezentuje zarovnanie vzajomne suvisiacich sekvencii

  • mame mech, v ktorom je napr.
    • po 21% guliciek oznacenych AA, TT
    • po 14% oznacenych CC, GG
    • po 2.4% oznacenych AC, AG, CA, CT, GA, GT, TC, TG
    • po 3.6% oznacenych AT, TA
    • po 1.6% oznacenych AG, GC.
  • Spolu mame 70% guliciek oznacenych rovnakymi pismenami, 30% roznymi
  • n krat z mecho vytiahneme gulicku a pismena piseme ako stlpce zarovnania.
  • aka je pravdepodobnost, ze dostaneme ACT zarovnane s ACC?
  • Pr(A1=AA)*Pr(A2=CC)*Pr(A3=TC) = 0.21*0.14*0.024 = 0.0007056

Skore zarovnania je log Pr(zarovnania v H)/Pr(zarovnania v R), t.j. log (0.0007056 / 0.000216) = 0.514105 (pre desiatkovy logaritmus)

  • kladne skore znamena, ze model H lepsie zodpoveda datam (zarovnaniu) ako model R
  • zaporne skore znamena, ze model R lepsie zodpoveda datam

Cvicenie pri pocitaci

  • Stiahnite si subor [4], ulozte si ho a otvorte v openoffice
  • V zalozke Matica vyplnte do zltej oblasti vzorce na vypocet pravdepodobnosti kratkeho zarovnania, logaritmus pomeru pravdepodobnosti a sucet skore, pricom vo vzorcoch pouzijete odkazy na policka v riadkoch 11-15, stlpcoch B a E
  • Sucet skore by mal zhruba rovny desatnasobku logaritmu pomeru - preco vidime rozdiely?
  • Potom skusajte menit %GC a %identity v hornych riadkoch tabulky a pozrite sa, ako to ovplyvni skorovanie. Vysledne skore zo stlpca E rucne prepiste (bez formul) do tabulky v zalozke Vysledky. Preco nastavaju take zmeny ako vidite?

Pouzitie pravdepodobnosti na analyzu potrebneho pokrytia pri sekvenovani

Nerobili sme, uvedene pre zaujimavost

  • Pozrite tiez grafy k pravdepodobnosti: http://compbio.fmph.uniba.sk/vyuka/mbi/poznamky/ci02.pdf
  • Nas problem: spocitanie pokrytia
    • G = dlzka genomu, napr. 1 000 000 (predpokladajme, že je cirkulárny)
    • N = pocet segmentov (readov), napr. 10 000
    • L = dlzka readu, napr. 1000
    • Celkova dlzka segmentov NL, pokrytie (coverage) NL/G, v nasom pripade 10x
    • V priemere kazda baza pokryta 10x
    • Niektore su ale pokryte viackrat, ine menej.
    • Zaujimaju nas otazky typu: kolko baz ocakavame, ze bude pokrytych menej ako 3x?
    • Dolezite pri planovani experimentov (ake velke pokrytie potrebujem na dosiahnutie urcitej kvality)
  • Pokrytie genomu: predpokladame, ze kazdy segment zacina na nahodnej pozicii zo vsetkych moznych G
  • Takze ak premenna Y_i bude zaciatok i-teho segmentu, jej rozdelenie bude rovnomerne
    • P(Y_i=1) = P(Y_i=2) = ... = P(Y_i=G) = 1/G
  • Aka je pravdepodobnost ze nejaky konkretny i-ty segment pokryva konkretnu poziciu j?
    • P(Y_i>=j-L+1 and Y_i<=j) = P(Y_i=j-L+1)+...+P(Y_i=j) = L/G, oznacme tuto hodnotu p, nasom priklade p=0.001 (1 promile)
  • Uvazujme premennu X_j, ktora udava pocet segmentov pokryvajucich poziciu j
    • mozne hodnoty 0..N
    • i-ty segment pretina poziciu j s pravdepodobnostou p=L/G
    • to iste ako keby sme N krat hodili mincou, na ktorej spadne hlava s pravd. p a znak 1-p a oznacili ako X_j pocet hlav
    • Priklad: majme mincu, ktora ma hlavu s pr. 1/4 a hodime je 3x.
HHH 1/64
HHT 3/64
HTH 3/64
HTT 9/64
THH 3/64
THT 9/64
TTH 9/64
TTT 27/64
  • P(X_j=3) = 1/64, P(X_j=2)=9/64, P(X_j=1)=27/64, P(X_j=0)=27/64
    • taketo rozdelenie pravdepodobnosti sa vola binomicke
    • P(X_j = k) = (N choose k) p^k (1-p)^(N-k), kde {N \choose k}={\frac  {N!}{k!(N-k)!}} a n! = 1*2*...*n
    • napr pre priklad s troma hodmi kockou P(X_j=2) = 3!/(2!*1!) * (1/4)^2 * (3/4)^1 = 9/64
    • Zle sa pocita pre velke N, preto sa niekedy pouziva aproximacia Poissonovym rozdelenim s parametrom lambda = Np, ktore ma e^{{-\lambda }}\lambda ^{k}/k!
    • Spat k sekvenovaniu: vieme spocitat rozdelenie pravdepodobnosti a tiez napr. P(X_i<3) = P(X_i=0)+P(X_i=1)+P(X_i=2) = 0.000045+0.00045+0.0023=0.0028 (v priemere ocakavame 45 baz nepokrytych, 2800 pokrytých menej ako 3 krát)
    • Takyto graf, odhad, vieme lahko spravit pre rozne pocty segmentov a tak naplanovat, kolko segmentov potrebujeme
  • Chceme tiez odhadnut pocet kontigov (nebrali sme na cviceni, uvedene len pre zaujimavost)
    • Ak niekolko baz vobec nie je pokrytych segmentami, prerusi sa kontig
    • Vieme, kolko baz je v priemere nepokrytych, ale niektore mozu byt vedla seba
    • Novy kontig vznikne aj ak sa susedne segmenty malo prekryvaju
    • Predpokladajme, ze na spojenie dvoch segmentov potrebujeme prekryv aspon T
    • Lander a Waterman 1988 odhadli, ze dany segment ma pravdepodobnost zhruba exp(-N(L-T)/G), ze bude posledny v kontigu
    • Pre N segmentov dostaneme priemerny pocet kontigov N*exp(-N(L-T)/G)
    • Ako keby sme dlzku segmentu skratili o dlzku prekryvu
    • Pre T=50 dostaneme priemerny pocet kontigov 0.75 (v skutocnosti ide skor o pocet koncov kontigov - ak dostaneme cely kruh, tento pocet je 0, preto dostavame priemer nizsi ako 1)
    • ak znizime N na 5000 (5x pokrytie) dostaneme 44 kontigov
  • Tento jednoduchy model nepokryva vsetky faktory:
    • Segmenty nemaju rovnaku dlzku
    • Problemy v zostavovani kvoli chybam, opakovaniam a pod.
    • Segmenty nie su rozlozene rovnomerne (cloning bias a pod.)
    • Vplyv koncov chromozomov pri linearnych chromozomoch
    • Uzitocny ako hruby odhad
    • Na spresnenie mozeme skusat spravit zlozitejsie modely, alebo simulovat data
  • Poznamka: pravdepodobnosti z binomickeho rozdelenia mozeme lahko spocitat napr. statistickym softverom R. Tu su prikazy, ktore sa na to hodia, pre pripad, ze by vas to zaujimalo:
dbinom(10,1e4,0.001);  #(12.5% miest ma pokrytie presne 10)
pbinom(10,1e4,0.001,lower.tail=TRUE); #(58% miest ma pokrytie najviac 10)
dbinom(0:30,1e4,0.001); #tabulka pravdepodobnosti
 [1] 4.517335e-05 4.521856e-04 2.262965e-03 7.549258e-03 1.888637e-02
 [6] 3.779542e-02 6.302390e-02 9.007019e-02 1.126216e-01 1.251601e-01
[11] 1.251726e-01 1.137933e-01 9.481826e-02 7.292252e-02 5.207187e-02
[16] 3.470068e-02 2.167707e-02 1.274356e-02 7.074795e-03 3.720595e-03
[21] 1.858621e-03 8.841718e-04 4.014538e-04 1.743354e-04 7.254524e-05
[26] 2.897743e-05 1.112843e-05 4.115040e-06 1.467156e-06 5.050044e-07
[31] 1.680146e-07

Zhrnutie

  • Pravdedpobnostny model: myslienkovy experiment, v ktorom vystupuje nahoda, napr. hod idealizovanou kockou
  • Vysledok je hodnota, ktoru budeme volat nahodna premenna
  • Tabulka, ktora pre kazdu moznu hodnotu nahodnej premennej urci je pravdepodobnost sa vola rozdelenie pravdepodobnosti, sucet hodnot v tabulke je 1
  • Znacenie typu P(X=7)=0.1
  • Priklad: mame genom dlzky G=1mil., nahodne umiestnime N=10000 segmentov dlzky L=1000
  • Nahodna premenna X_i je pocet segmentov pokryvajucich urcitu poziciu i
  • Podobne, ako keby sme N krat hodili kocku, ktora ma cca 1 promile sancu padnu ako hlava a 99.9% ako znak a pytame sa, kolko krat padne znak (1 promile sme dostali po zaukruhleni z L/(G-L+1))
  • Rozdelenie pravdepobnosti sa v tomto pripade vola binomicke a existuje vzorec, ako ho spocitat
  • Takyto model nam moze pomoct urcit, kolko segmentov potrebujeme osekvenovat, aby napr. aspon 95% pozicii bolo pokrytych aspon 4 segmentami

Evolúcia, cvičenia pre informatikov

Felsensteinov algoritmus 1981

  • Mame dany strom T s dlzkami hran a bazy v listoch (jeden stlpec zarovnania) a model substitucii P (zadany napr. maticou rychlosti, vid nizsie). Spocitajme pravdepodobnost, ze z modelu dostaneme prave tuto kombinaciu baz v listoch.
  • Oznacenie:
    • Nech X_v je premenna reprezentujuca bazu vo vrchole v a nech x_v je konkretna baza v liste v.
    • Nech listy su 1..n a vnut. vrcholy n+1..2n-1, pricom koren je 2n-1.
    • Nech p_v je rodic vrchola v a nech dlzka hrany z v do rodica je t_v.
    • Nech P(a|b,t) je pravdepodobnost, ze b sa zmeni na a za cas t (spocitame z matice R, uvidime neskor ako).
      • Napr. v Jukes-Cantorovom modeli P(A|A,t)=(1+3e^{{-{\frac  {4}{3}}t}})/4, P(C|A,t)=(1-e^{{-{\frac  {4}{3}}t}})/4
    • Nech q_a je pravdepodobnost bazy a v koreni (ekvilibrium matice R)
      • Napr. v Jukes-Cantorovom modeli q_a = 1/4
  • Ak by sme poznali bazy vo vsetkych vrcholoch, mame P(X_{1}=x_{1}\dots X_{{2n-1}}=x_{{2n-1}}|T,R)=q_{{x_{{2n-1}}}}\prod _{{v=1}}^{{2n-2}}P(x_{v}|x_{{p_{v}}},t_{v})
  • Chceme pravdepodobnost P(X_{1}=x_{1},X_{2}=x_{2},\dots X_{n}=x_{n}|T,R)=\sum _{{x_{{n+1}}\dots x_{{2n-1}}\in \{A,C,G,T\}^{{n-1}}}}P(X_{1}=x_{1}\dots X_{{2n-1}}=x_{{2n-1}}|T,R)
  • Pocitat sucet cez exponencialne vela dosadeni hodnot za vnutorne vrcholy je neefektivne, spocitame rychlejsie dynamickym programovanim.
  • Nech A[v,a] je pravdepodobnost dat v podstrome s vrcholom v ak X_v=a
  • A[v,a] pocitame od listov ku korenu
  • V liste A[v,a] = [a=x_v]
  • Vo vnut. vrchole s detmi y a z mame A[v,a]=\sum _{{b,c}}A[y,b]A[z,c]P(b|a,t_{y})P(c|a,t_{z})
  • Celkova pravdepodobnost je P(X_{1}=x_{1},X_{2}=x_{2},\dots X_{n}=x_{n}|T,R)=\sum _{a}A[r,a]q_{a} pre koren r.

Zlozitost, zlepsenie

  • Zlozitost O(n|\Sigma |^{3})
  • Pre nebinarne stromy exponencialne
  • Zlepsenie A[v,a]=(\sum _{{b}}A[y,b]P(b|a,t_{y}))(\sum _{c}A[z,c](c|a,t_{z}))
  • Zlozitost O(n|\Sigma |^{2}) aj pre nebinarne stromy

Chybajuce data

  • Ak v niektorom liste mame neznamu bazu N, nastavime A[v,a]=1
  • Podobne sa spracovavaju medzery v zarovnani, aj ked mohli by sme mat aj model explicitne ich modelujuci

Aposteriorna pravdepodobnost (nerobili sme)

  • Co ak chceme spocitat pravdepodobnost P(X_v=a|X_1=x_1, X_2=x_2,\dots X_n=x_n,T,R)? Zaujimaju nas teda sekvencie genomov predkov.
  • Potrebujeme B[v,a]=pravdpodobnost dat ak podstrom v nahradim listom s bazou a.
  • B[v,a] pocitame od korena k listom
  • V koreni B[v,a] = q_a
  • Vo vrchole v s rodicom u a surodencom x mame B[v,a]=\sum _{{b,c}}B[u,b]A[x,c]P(a|b,t_{v})P(c|b,t_{v})
  • Ziadana pravdepodobnost je B[v,a]A[v,a]/P(X_{1}=x_{1},X_{2}=x_{2},\dots X_{n}=x_{n}|T,R)

Substitucne modely - odvodenie

  • Nech P(b|a,t) je pravdepodobnost, ze ak zacneme s bazou a, tak po case t budeme mat bazu b.
  • Pre dane t mozeme take pravdepodobnosti usporiadat do matice 4x4 (ak studujeme DNA), kde S(t)_{{a,b}}=P(b|a,t)
  • Intuitivne cim vacsie t, tym vacsia pravdepodobnost zmeny; S(0)=I (jednotkova matica), S(t),t\rightarrow \infty ma vsetky riadky rovnake, napr. 1/4, 1/4, 1/4, 1/4
  • Ak mame matice pre casy t_{1} a t_{2}, vieme spocitat maticu pre cas t_{1}+t_{2}: P(b|a,t_{1}+t_{2})=\sum _{x}P(x|a,t_{1})\cdot P(b|x,t_{2}) a teda v maticovej notacii S(t_{1}+t_{2})=S(t_{1})S(t_{2}). Takyto model nazyvame multiplikativny a predpoklada, ze pravdepodobnost mutacie zavisi len od aktualnej bazy, nie od minulych stavov.
  • Ak by sme uvazovali iba diskretne (celocislene) casy, stacilo by nam urcit iba S(1) a vsetky ostatne casy dostaneme umocnenim tejto matice. Je vsak elegantnejsie mat S(t) definovane aj pre realne t.
  • Jukes-Cantor-ov model evolucie predpoklada, ze vsetky substitucie su rovnako pravdepodobne.
  • Matica teda musi vzyerat nejako takto
S(t)=\left({\begin{array}{cccc}1-3s(t)&s(t)&s(t)&s(t)\\s(t)&1-3s(t)&s(t)&s(t)\\s(t)&s(t)&1-3s(t)&s(t)\\s(t)&s(t)&s(t)&1-3s(t)\\\end{array}}\right)
S(2t)=S(t)^{2}=\left({\begin{array}{cccc}1-6s(t)+12s(t)^{2}&2s(t)-4s(t)^{2}&2s(t)-4s(t)^{2}&2s(t)-4s(t)^{2}\\\dots \end{array}}\right)
  • Pre velmi maly cas t je s(t) velmi male cislo (blizke 0) a pre velmi male s(t) su kvadraticke cleny s(t)^{2} ovela mesne ako linearne cleny s(t) a teda
S(2\epsilon )=S(\epsilon )^{2}\approx \left({\begin{array}{cccc}1-6s(\epsilon )&2s(\epsilon )&2s(\epsilon )&2s(\epsilon )\\\dots \end{array}}\right)
  • Vytvorme si teraz maticu rychlosti (rate matrix), kde \alpha \approx s(\epsilon )/\epsilon
R=\left({\begin{array}{cccc}-3\alpha &\alpha &\alpha &\alpha \\\alpha &-3\alpha &\alpha &\alpha \\\alpha &\alpha &-3\alpha &\alpha \\\alpha &\alpha &\alpha &-3\alpha \\\end{array}}\right)
  • Dostavame, ze pre velmi male casy plati S(\epsilon ')\approx I+R\epsilon ' (skusme dosadit \epsilon '=\epsilon , \epsilon '=2\epsilon ...)
  • S(t+\epsilon )=S(t)S(\epsilon )\approx S(t)(I+R\epsilon ) a teda (S(t+\epsilon )-S(t))/\epsilon \approx S(t)R
  • V limite dostaneme S(t)R=\lim _{{\epsilon \rightarrow 0}}(S(t+\epsilon )-S(t))/\epsilon =S'(t) (diferencialne rovnice, pociatocny stav S(0)=I).
  • Nasobenim matic S(t) a R dostavame, ze diagonalny prvok S(t)R je -3\alpha +12\alpha s(t) a nediagonalny \alpha -4\alpha s(t). Takze dostavame diferencialnu rovnicu s'(t)=\alpha -4\alpha s(t) z rovnosti nediagonalnych prvkov (z rovnosti diagonalnych prvkov dostavame tu istu rovnicu len prenasobenu konstantou -3).
  • Overme, ze riesenim tejto rovnice je s(t)=(1-e^{{-4\alpha t}})/4:
Zderivujeme s'(t)=\alpha e^{{-4\alpha t}}, dosadime do rovnice.
  • \alpha je teda pravdepodobnost zmeny za jednotku casu, ak uvazujeme velmi kratke casy alebo derivacia prvku s(t) vzhladom na t v bode 0


  • Takze mame maticu:
S(t)=\left({\begin{array}{cccc}(1+3e^{{-4\alpha t}})/4&(1-e^{{-4\alpha t}})/4&(1-e^{{-4\alpha t}})/4&(1-e^{{-4\alpha t}})/4\\\dots \end{array}}\right)
  • Ked t\rightarrow \infty , dostavame r(t)=s(t)=1/4.
  • V case t je pravdepodobnost, ze uvidime zmenenu bazu D_{t}={\frac  {3}{4}}(1-e^{{-4\alpha t}}) a teda ak v skutocnosti vidime d\% zmenenych baz, vieme spatne zratat t, ktore by hodnote D_{t}=d prinalezalo.
  • Aby sme nemali naraz aj \alpha aj t, zvykneme maticu R normalizovat tak, aby priemerny pocet substitucii za jednotku casu bol 1. V pripade Jukes-Cantorovho modelu je to ked \alpha =1/3.
  • Dostavame teda vzorec pre vzdialenost, ktory sme videli na prednaske t=-{\frac  {3}{4}}\log \left(1-{\frac  {4}{3}}d\right)
  • Ak d\rightarrow 0.75, dostavame t\rightarrow \infty
  • Preco sme ten vzorec odvodili takto? V skutocnosti chceme najst najvierohodnejsiu hodnotu t, t.j. taku, pre ktore hodnota P(data|t) bude najvacsia. Zhodou okolnosti vyjde takto.

Nástroje na zarovnávanie a fylogenetické stromy, cvičenia pre biológov

Priklady praktickych programov

Pozrime sa na niekolko nastrojov, vsimnime si, ake poskytuju nastavenia a co vypisuju na vystupe, dajme to do suvisu s prednaskami

Plne dynamicke programovanie

>sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2
>tr|B1AKP8|B1AKP8_HUMAN FK506 binding protein 12-rapamycin associated protein 1 OS=Homo sapiens GN=FRAP1 PE=4 SV=1

Proteínové sekvencie a zarovnania

>sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2
MDRLVFSYCPSSKVTARFLVKFCFIEYQDSQEPCICTIQLFSGNESGSLMQKCFVSKIPN
KSLLPTELSKISTHEWLDFGVTVSELSLNAKFVVSAWKPSFNDEEVYEFVGCTTYRLFDE
NNLLRQGLQKIPLQTSKEIKKYSPTSLELEQVKEINRLDGLLLKLQLGDVPSVNWLDDIS
FGKIKDFRSKHMSLVTIPILYLDFLQFSFPVVFQRSYYPKSENRVYYSSFDLELNLDSPA
ELKHRRLVRSQRNGPLDKDLKPNSKIRKELESILSYPPSEELSLEEKDLIWKFRFYLTRN
KKAMTKFLKSVVWTDSSEVNQALSLLDSWTEIDIDDALELLSPSFVHPKVRAYAVSRLET
ASNEELLLYLLQLVQALRYDNPISSDERFQPSPLALFLVNRAISSPSIGNDLYWYLVVEI
EDEPVSKLFSSVMFLFQKELSKSVEGRLIRETLSAQAKFVEKLLRISKSVQSFRGTRLKK
IEYLKVLLEDHKYHLLDFHALPLPLDPSVNIVGIIPDACTVFKSTMQPLRLLFKCQDGSK
YPIIFKNGDDLRQDQLVIQILTLMDKLLKKEKLDLHLKPYRILATGPTHGAVQFVPSKTL
ATILAEYHGSVLAYLRENNPDDGLNSANYGIDPVAMDNYVRSCAGYCVITYLLGVGDRHL
DNLLITKDGHFFHADFGYILGRDPKLFSPAMKLSKEMVEGMGGYNSPFYQQFKSYCYTTF
TALRKSSNLILNLFSLMVDANIPDIKFDKEKVVYKVKERFCLQMSESDAIKYFEQLINDS
VSALFPQIIDRMHNLAQYMRS
>tr|B1AKP8|B1AKP8_HUMAN FK506 binding protein 12-rapamycin associated protein 1 OS=Homo sapiens GN=FRAP1 PE=4 SV=1
MNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAES
TENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGH
WPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYP
LTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEAS
RLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVK
DLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQS
IAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTS
LRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDY
DHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILG
LGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGN
YRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSV
EILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSH
DDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
########################################
# Program: water
# Rundate: Thu 11 Oct 2012 09:37:58
# Commandline: water
#    -asequence ggg1
#    -bsequence ggg2
#    -outfile ggg12.w
# Align_format: srspair
# Report_file: ggg12.w
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: VPS34_SCHPO
# 2: B1AKP8_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 645
# Identity:     124/645 (19.2%)
# Similarity:   221/645 (34.3%)
# Gaps:         211/645 (32.7%)
# Score: 226.0
# 
#
#=======================================

VPS34_SCHPO      235 NLDSPAELKHRRLVRSQRNGPLDKDLKPNSKIRKELESILSYPPSEELSL    284
                     |.:|.||        |..|.|....|:  .|:.::|...|          
B1AKP8_HUMAN      53 NSESEAE--------STENSPTPSPLQ--KKVTEDLSKTL----------     82

VPS34_SCHPO      285 EEKDLIWKFRFYLTRNKKAMTKFLKSVVWTDSSEVNQALSLLDSWTEI--    332
                                 |.....|:..|.:|:..:..:.:...|.:|..|.:.  
B1AKP8_HUMAN      83 ------------LMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGH    120

VPS34_SCHPO      333 --DIDDALELLSPSFVHPKVRAYAVSRLETASNEELLLYLLQLVQAL--R    378
                       |:::||           |......:::|         .||::..|  |
B1AKP8_HUMAN     121 WPDVNEAL-----------VEGVKAIQIDT---------WLQVIPQLIAR    150

VPS34_SCHPO      379 YDNP-----------ISSDERFQPS----PLAL-----------------    396
                     .|.|           ::...|:.|.    ||.:                 
B1AKP8_HUMAN     151 IDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKIL    200

VPS34_SCHPO      397 --------FLVNRA--ISSPSIGNDLYWYLVVEIEDEPVSKLF---SSVM    433
                             .||.:|  :|...|...:.|:.:.....|..|:|:   .:|.
B1AKP8_HUMAN     201 KNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVK    250

VPS34_SCHPO      434 FLFQ----------------KELS-----------------KSVEGRLIR    450
                     .:|:                ||.|                 |.::...::
B1AKP8_HUMAN     251 GMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVK    300

VPS34_SCHPO      451 ETLSAQAKFVEKLLRISKSVQSFRGTRLKKIEYLKVLLEDHKYHLLDFHA    500
                     :...|...:.....||||.:.......|:.:....::..|.:.      |
B1AKP8_HUMAN     301 DLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLEL------A    344

VPS34_SCHPO      501 LPLPLDPSVNIVGI--IPDACTVFKSTMQPLRLLFKCQDGSKYPIIFKNG    548
                     :|...||:..|:.|  |..:..|..|..:|.:|.....:|.::..:.|..
B1AKP8_HUMAN     345 VPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGH    394

VPS34_SCHPO      549 DDLRQDQLVIQILTLMDKLLKKE----KLDLHLKPYRILATGPTHGAVQF    594
                     :|||||:.|:|:..|::.||..:    :.:|.::.|.::......|.:.:
B1AKP8_HUMAN     395 EDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGW    444

VPS34_SCHPO      595 VP-SKTLATILAEYHG-----------------------------SVLAY    614
                     || ..||..::.:|..                             .|..:
B1AKP8_HUMAN     445 VPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEH    494

VPS34_SCHPO      615 LRENNPDDGLNSANYGIDP---VAMD---NYVRSCAGYCVITYLLGVGDR    658
                     ...|...|.|....:...|   |..|   ||.||.|...::.|:||:|||
B1AKP8_HUMAN     495 AVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR    544

VPS34_SCHPO      659 HLDNLLITK-DGHFFHADFG--------------YILGRDPKLFSPAMKL    693
                     |..||::.: .|...|.|||              .|..|..::.:.||: 
B1AKP8_HUMAN     545 HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAME-    593

VPS34_SCHPO      694 SKEMVEGMGGYNSPFYQQFKSYCYTTFTALRKSSNLILNLFSLMV    738
                         |.|:.|       .::..|:|....||:..:.::.:....|
B1AKP8_HUMAN     594 ----VTGLDG-------NYRITCHTVMEVLREHKDSVMAVLEAFV    627
########################################
# Program: needle
# Rundate: Thu 11 Oct 2012 09:40:40
# Commandline: needle
#    -asequence ggg1
#    -bsequence ggg2
#    -endweight
#    -outfile ggg12.n2
# Align_format: srspair
# Report_file: ggg12.n2
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: VPS34_SCHPO
# 2: B1AKP8_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 948
# Identity:     167/948 (17.6%)
# Similarity:   292/948 (30.8%)
# Gaps:         341/948 (36.0%)
# Score: 130.5
# 
#
#=======================================

VPS34_SCHPO        1 MD-RLVFSYCPSSKVTARFLVKFCFIEYQDSQEPCICTIQLFSGNESGSL     49
                     |: ..|..|                 ::|:            ...:....
B1AKP8_HUMAN       1 MNFEAVLHY-----------------KHQN------------QARDEKKK     21

VPS34_SCHPO       50 MQKCFVSKIPNKSLLPTELSKISTHEWLDFGVTVSELSLNAKFVVSAWKP     99
                     ::....:.|.|.:...|..:..:|                     :|...
B1AKP8_HUMAN      22 LRHASGANITNATTAATTAATATT---------------------TASTE     50

VPS34_SCHPO      100 SFNDEEVYEFVGCTTYRLFDENNLLRQGLQ-KIPLQTSKEIKKYSPTSLE    148
                     ..|.|...|..         ||:.....|| |:....||.:..|:..:::
B1AKP8_HUMAN      51 GSNSESEAEST---------ENSPTPSPLQKKVTEDLSKTLLMYTVPAVQ     91

VPS34_SCHPO      149 ----LEQVKEINRLDGLLLKLQLGDVPSVNWLDDISFGKIKDFRSKHMSL    194
                         ...:...|.|...|..|.|       |.|   :|...|...   :|
B1AKP8_HUMAN      92 GFFRSISLSRGNNLQDTLRVLTL-------WFD---YGHWPDVNE---AL    128

VPS34_SCHPO      195 VT-IPILYLDFLQFSFPVVFQRSYYPKSENRVYYSSFDLELNLDSP----    239
                     |. :..:.:|......|.:..|                    :|:|    
B1AKP8_HUMAN     129 VEGVKAIQIDTWLQVIPQLIAR--------------------IDTPRPLV    158

VPS34_SCHPO      240 AELKHRRLVRSQRNGPLDKDLKPNSKIRKELESILSYPPSEELSLEEKDL    289
                     ..|.|:.|....|..|                ..|.||    |::..|..
B1AKP8_HUMAN     159 GRLIHQLLTDIGRYHP----------------QALIYP----LTVASKST    188

VPS34_SCHPO      290 IWKFRFYLTRNKKAMTKFLKSVVWTDSSEVNQALSLLDSWTEIDI-----    334
                            .|....|..|.||::....::.|.||:.:.:....:.|     
B1AKP8_HUMAN     189 -------TTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEM    231

VPS34_SCHPO      335 -DDALELLSPSFVHPKVRAYAVSRLETASNEELLLYLLQLVQALRYDNPI    383
                      .:.||..|        |.|...|     |.:.:..:|:.:.|:.     
B1AKP8_HUMAN     232 WHEGLEEAS--------RLYFGER-----NVKGMFEVLEPLHAMM-----    263

VPS34_SCHPO      384 SSDERFQPSPLALFLVNRAISSPSIGNDLYWYLVVEIEDEPVSKLFSSVM    433
                        || .|..|.....|:|     .|.||     :|.             
B1AKP8_HUMAN     264 ---ER-GPQTLKETSFNQA-----YGRDL-----MEA-------------    286

VPS34_SCHPO      434 FLFQKELSKSVEGRLIRETLSAQAKFVEKLLRISKSVQSFRGTRLKKIEY    483
                        |:...|.::...:::...|...:.....||||.:.......|:.:..
B1AKP8_HUMAN     287 ---QEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP    333

VPS34_SCHPO      484 LKVLLEDHKYHLLDFHALPLPLDPSVNIVGI--IPDACTVFKSTMQPLRL    531
                     ..::..|.:.      |:|...||:..|:.|  |..:..|..|..:|.:|
B1AKP8_HUMAN     334 KLLMCRDLEL------AVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKL    377

VPS34_SCHPO      532 LFKCQDGSKYPIIFKNGDDLRQDQLVIQILTLMDKLLKKE----KLDLHL    577
                     .....:|.::..:.|..:|||||:.|:|:..|::.||..:    :.:|.:
B1AKP8_HUMAN     378 TLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSI    427

VPS34_SCHPO      578 KPYRILATGPTHGAVQFVP-SKTLATILAEYHG-----------------    609
                     :.|.::......|.:.:|| ..||..::.:|..                 
B1AKP8_HUMAN     428 QRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMA    477

VPS34_SCHPO      610 ------------SVLAYLRENNPDDGLNSANYGIDP---VAMD---NYVR    641
                                 .|..:...|...|.|....:...|   |..|   ||.|
B1AKP8_HUMAN     478 PDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTR    527

VPS34_SCHPO      642 SCAGYCVITYLLGVGDRHLDNLLITK-DGHFFHADFG-------------    677
                     |.|...::.|:||:||||..||::.: .|...|.|||             
B1AKP8_HUMAN     528 SLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFP    577

VPS34_SCHPO      678 -YILGRDPKLFSPAMKLSKEMVEGMGGYNSPFYQQFKSYCYTTFTALRKS    726
                      .|..|..::.:.||:     |.|:.|       .::..|:|....||:.
B1AKP8_HUMAN     578 EKIPFRLTRMLTNAME-----VTGLDG-------NYRITCHTVMEVLREH    615

VPS34_SCHPO      727 SNLILNLFSLMV----------DAN-------------------------    741
                     .:.::.:....|          |.|                         
B1AKP8_HUMAN     616 KDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG    665

VPS34_SCHPO      742 --------------IPD----------IK---FDKE--KVVYKVKERFC-    761
                                   :|:          :|   .:|:  :::.:|:::.. 
B1AKP8_HUMAN     666 VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTG    715

VPS34_SCHPO      762 LQMSESDAI---KYFEQLINDSVSALFPQIIDRMHNLAQYMRS-----    801
                     ...|..|.:   ...|.||..:.|         ..||.|....     
B1AKP8_HUMAN     716 RDFSHDDTLDVPTQVELLIKQATS---------HENLCQCYIGWCPFW    754
########################################
# Program: needle
# Rundate: Thu 11 Oct 2012 09:37:33
# Commandline: needle
#    -asequence ggg1
#    -bsequence ggg2
#    -outfile ggg12.n
# Align_format: srspair
# Report_file: ggg12.n
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: VPS34_SCHPO
# 2: B1AKP8_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 1060
# Identity:     138/1060 (13.0%)
# Similarity:   245/1060 (23.1%)
# Gaps:         565/1060 (53.3%)
# Score: 206.0
# 
#
#=======================================

VPS34_SCHPO        1 MDRLVFSYCPSSKVTARFLVKFCFIEYQDSQEPCICTIQLFSGNESGSLM     50
                                                                       
B1AKP8_HUMAN       0 --------------------------------------------------      0

VPS34_SCHPO       51 QKCFVSKIPNKSLLPTELSKISTHEWLDFGVTVSELSLNAKFVVSAWKPS    100
                                                                       
B1AKP8_HUMAN       0 --------------------------------------------------      0

VPS34_SCHPO      101 FNDEEVYEFVGCTTYRLFDENNLLRQGLQKIPLQTSKEIKKYSPTSLELE    150
                                                                       
B1AKP8_HUMAN       0 --------------------------------------------------      0

VPS34_SCHPO      151 QVKEINRLDGLLLKLQLGDVPSVNWLDDISFGKIKDFRSKHMSLVTIPIL    200
                                                                       
B1AKP8_HUMAN       0 --------------------------------------------------      0

VPS34_SCHPO      201 YLDFLQFSFPVVFQRSYYPKSENRVYYSSFDLELNLDSPAELKHRRLVRS    250
                                                      :|.::....||:...|.
B1AKP8_HUMAN       1 ---------------------------------MNFEAVLHYKHQNQARD     17

VPS34_SCHPO      251 QRNGPLDKDLK--------------------------PNSKIRKELESIL    274
                     ::     |.|:                          ..|....|.||..
B1AKP8_HUMAN      18 EK-----KKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTE     62

VPS34_SCHPO      275 SYP-PSEELSLEEKDLIWKFRFYLTRNKKAMTKFLKSVVWTDSSEVNQAL    323
                     :.| ||.......:||......|..   .|:..|.:|:..:..:.:...|
B1AKP8_HUMAN      63 NSPTPSPLQKKVTEDLSKTLLMYTV---PAVQGFFRSISLSRGNNLQDTL    109

VPS34_SCHPO      324 SLLDSWTEI----DIDDALELLSPSFVHPKVRAYAVSRLETASNEELLLY    369
                     .:|..|.:.    |:::||           |......:::|         
B1AKP8_HUMAN     110 RVLTLWFDYGHWPDVNEAL-----------VEGVKAIQIDT---------    139

VPS34_SCHPO      370 LLQLVQAL--RYDNP-----------ISSDERFQPS----PLAL------    396
                     .||::..|  |.|.|           ::...|:.|.    ||.:      
B1AKP8_HUMAN     140 WLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTT    189

VPS34_SCHPO      397 -------------------FLVNRA--ISSPSIGNDLYWYLVVEIEDEPV    425
                                        .||.:|  :|...|...:.|:.:.....|..
B1AKP8_HUMAN     190 TARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEA    239

VPS34_SCHPO      426 SKLF---SSVMFLFQ----------------KELS---------------    441
                     |:|:   .:|..:|:                ||.|               
B1AKP8_HUMAN     240 SRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEW    289

VPS34_SCHPO      442 --KSVEGRLIRETLSAQAKFVEKLLRISKSVQSFRGTRLKKIEYLKVLLE    489
                       |.::...:::...|...:.....||||.:.......|:.:....::..
B1AKP8_HUMAN     290 CRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCR    339

VPS34_SCHPO      490 DHKYHLLDFHALPLPLDPSVNIVGI--IPDACTVFKSTMQPLRLLFKCQD    537
                     |.:.      |:|...||:..|:.|  |..:..|..|..:|.:|.....:
B1AKP8_HUMAN     340 DLEL------AVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSN    383

VPS34_SCHPO      538 GSKYPIIFKNGDDLRQDQLVIQILTLMDKLLKKE----KLDLHLKPYRIL    583
                     |.::..:.|..:|||||:.|:|:..|::.||..:    :.:|.::.|.::
B1AKP8_HUMAN     384 GHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVI    433

VPS34_SCHPO      584 ATGPTHGAVQFVP-SKTLATILAEYHG-----------------------    609
                     ......|.:.:|| ..||..::.:|..                       
B1AKP8_HUMAN     434 PLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHL    483

VPS34_SCHPO      610 ------SVLAYLRENNPDDGLNSANYGIDP---VAMD---NYVRSCAGYC    647
                           .|..:...|...|.|....:...|   |..|   ||.||.|...
B1AKP8_HUMAN     484 TLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMS    533

VPS34_SCHPO      648 VITYLLGVGDRHLDNLLITK-DGHFFHADFG--------------YILGR    682
                     ::.|:||:||||..||::.: .|...|.|||              .|..|
B1AKP8_HUMAN     534 MVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFR    583

VPS34_SCHPO      683 DPKLFSPAMKLSKEMVEGMGGYNSPFYQQFKSYCYTTFTALRKSSNLILN    732
                     ..::.:.||:     |.|:.|       .::..|:|....||:..:.::.
B1AKP8_HUMAN     584 LTRMLTNAME-----VTGLDG-------NYRITCHTVMEVLREHKDSVMA    621

VPS34_SCHPO      733 LFSLMV----------DANIPDIKFDKEKVVYKVKERFCLQMSESDAIKY    772
                     :....|          |.|....|..:.:                     
B1AKP8_HUMAN     622 VLEAFVYDPLLNWRLMDTNTKGNKRSRTR---------------------    650

VPS34_SCHPO      773 FEQLINDSVSA-LFPQIIDRMHNLAQYMRS--------------------    801
                          .||.|| ...:|:|.: .|.:....                    
B1AKP8_HUMAN     651 -----TDSYSAGQSVEILDGV-ELGEPAHKKTGTTVPESIHSFIGDGLVK    694

VPS34_SCHPO      801 --------------------------------------------------    801
                                                                       
B1AKP8_HUMAN     695 PEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLC    744

VPS34_SCHPO      801 ----------    801
                               
B1AKP8_HUMAN     745 QCYIGWCPFW    754
<pre>

===NCBI Blast===
* NCBI BLAST http://blast.ncbi.nlm.nih.gov/ vela roznych nastrojov (porovnavanie DNA vs proteiny, pripadne translacia DNA na protein v 6 ramcoch)
** Heuristicky algoritmus, moze niektore zarovnania vynechat
** rozne nastavenia, vystup E-value

'''Low complexity masking:''' nepouzivat pri hladani jadier zarovnania regiony v ktorych sa velakrat opakuje ta ista aminokyselina
* Priklad (z ucebnice Zvelebil and Baum): 
<pre>
>sp|P04156|PRIO_HUMAN Major prion protein OS=Homo sapiens GN=PRNP PE=1 SV=1
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG

Bez maskovania vypise najpr aj toto zarovnanie:

>ref|NP_065842.1| serine/threonine-protein kinase TAO1 isoform 1 [Homo sapiens]
Length=1001

 Score = 45.1 bits (105),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 27/61 (44%), Gaps = 11/61 (18%)

Query  38   YPGQGSPGGNRYPPQGGGG--WGQPHGG---GWGQPHGGG---WGQPHGGGWGQPHGGGWG  90
            YPG     G  + P GG G  WG P GG    WG P  GG   WG P G   G P G   G
Sbjct  904  YPGAS---GWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMG  961

 Score = 40.0 bits (92),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 10/62 (16%)

Query  26   PKPGGW--NTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGG---WGQPHGGGWGQPHGGGWG  82
            P   GW  N  G   P  G P G   PPQ    WG P  GG   WG P G   G P G  
Sbjct  905  PGASGWSHNPTGGPGPHWGHPMGG--PPQA---WGHPMQGGPQPWGHPSGPMQGVPRGSSMG  961

Ak zapneme maskovanie, toto zarovnanie uz nenajde, v zarovnani sameho so sebou sa objavia male pismena alebo Xka:

>ref|NP_000302.1|major prion protein preproprotein [Homo sapiens]
Length=253

 Score =   520 bits (1340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%), Gaps = 0/253 (0%)

Query  1    MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYppqggggwgqp  60
            MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
Sbjct  1    MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP  60

Query  61   hgggwgqphgggwgqphgggwgqphgggwgqgggTHSQWNKPSKPKTNMKHMagaaaaga  120
            HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
Sbjct  61   HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA  120

Query  121  vvgglggymlgsamsRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV  180
            VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
Sbjct  121  VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV  180

Query  181  NITIKQHtvttttkgenftetDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSsppv  240
            NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
Sbjct  181  NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV  240

Query  241  illisfliflivG  253
            ILLISFLIFLIVG
Sbjct  241  ILLISFLIFLIVG  253

BLAT, chains, nets v UCSC browseri

  • Program BLAT v UCSC browseri http://genome.ucsc.edu/ rychlo vyhladava sekvencie v genome, ale nevie najst slabsie podobnosti
    • Vhodne pouzitie: zarovnanie EST ku genomu, presne urcenie suradnic nejakej sekvencie, a pod.
  • Net tracky v UCSC genome browseri nam umoznuju prechadzat medzi homologickymi oblastami roznych genomov

Prakticke cvicenie pri pocitaci: BLAT vs BLAST, nets v UCSC browseri

BLAT/BLAST

  • Na stránke so súbormi otvorte subor rtpcr-seq.txt. Obsahuje sekvenciu, ktorá vznikla pomocou RT-PCR na ľudských cDNA knižniciach
  • Choďte na UCSC genome browser http://genome.ucsc.edu/ , na modrej lište zvoľte BLAT, zadajte túto sekvenciu a hľadajte ju v ľudskom genóme. Akú podobnosť (IDENTITY) má najsilnejší nájdený výskyt? Aký dlhý úsek genómu zasahuje? (SPAN). Všimnite si, že ostatné výskyty sú oveľa kratšie.
  • V stĺpci ACTIONS si pomocou Details môžete pozrieť detaily zarovnania a pomocou Browser si pozrieť príslušný úsek genómu.
  • V tomto úseku genómu si zapnite track Vertebrate net na full a kliknutím na farebnú čiaru na obrázku pre tento track zistite, na ktorom chromozóme sliepky sa vyskytuje homologický úsek.
  • Skusme tu istu sekvenciu zarovnat ku genomu sliepky programom Blat: stlacte najprv na hornej modrej liste Genomes, zvolte Vertebrates a Chicken a potom na hornej liste BLAT. Do okienka zadajte tu istu sekvenciu. Akú podobnosť a dĺžku má najsilnejší nájdený výskyt teraz? Na ktorom je chromozóme?
  • Skúsme to isté v NCBI blaste: Choďte na http://blast.ncbi.nlm.nih.gov/ zvoľte nucleotide blast, database others a z menu reference genomic sequence, organism chicken (taxid:9031), program blastn
  • Aka je dlzka, identity a E-value najlepsieho zarovnania? Na ktorom je chromozome?

RT PCR sekvencia z cvičenia vyššie

AACCATGGGTATATACGACTCACTATAGGGGGATATCAGCTGGGATGGCAAATAATGATTTTATTTTGAC
TGATAGTGACCTGTTCGTTGCAACAAATTGATAAGCAATGCTTTCTTATAATGCCAACTTTGTACAAGAA
AGTTGGGCAGGTGTGTTTTTTGTCCTTCAGGTAGCCGAAGAGCATCTCCAGGCCCCCCTCCACCAGCTCC
GGCAGAGGCTTGGATAAAGGGTTGTGGGAAATGTGGAGCCCTTTGTCCATGGGATTCCAGGCGATCCTCA
CCAGTCTACACAGCAGGTGGAGTTCGCTCGGGAGGGTCTGGATGTCATTGTTGTTGAGGTTCAGCAGCTC
CAGGCTGGTGACCAGGCAAAGCGACCTCGGGAAGGAGTGGATGTTGTTGCCCTCTGCGATGAAGATCTGC
AGGCTGGCCAGGTGCTGGATGCTCTCAGCGATGTTTTCCAGGCGATTCGAGCCCACGTGCAAGAAAATCA
GTTCCTTCAGGGAGAACACACACATGGGGATGTGCGCGAAGAAGTTGTTGCTGAGGTTTAGCTTCCTCAG
TCTAGAGAGGTCGGCGAAGCATGCAGGGAGCTGGGACAGGCAGTTGTGCGACAAGCTCAGGACCTCCAGC
TTTCGGCACAAGCTCAGCTCGGCCGGCACCTCTGTCAGGCAGTTCATGTTGACAAACAGGACCTTGAGGC
ACTGTAGGAGGCTCACTTCTCTGGGCAGGCTCTTCAGGCGGTTCCCGCACAAGTTCAGGACCACGATCCG
GGTCAGTTTCCCCACCTCGGGGAGGGAGAACCCCGGAGCTGGTTGTGAGACAAATTGAGTTTCTGGACCC
CCGAAAAGCCCCCACAAAAAGCCG

Yass a dotploty

  • Program Yass hlada lokalne zarovnania v DNA sekvenciach, zobrazuje vo forme dot plotov
  • Na stranke UCSC genome browseru http://genome.ucsc.edu/ si zadajte ludsky genom, najnovsiu verziu (hg19)
  • V druhom okne/tabe si otvorte YASS server na adrese http://bioinfo.lifl.fr/yass/yass.php
  • V genome browseri zadajte region chr21:10,018,860-10,019,178
    • tento región obsahuje Alu repeat. Tieto opakovania tvoria cca 10% ľudského genómu, viac ako milión kópií
    • zobrazte si DNA sekvenciu tohto useku takto: na hornej modrej liste zvolte View, potom v podmenu DNA, na dalsej obrazovke tlacidlo get DNA
  • DNA sekvenciu Alu opakovania chceme zarovnat samu k sebe programom YASS
    • DNA sekvenciu Alu opakovania skopirujte do okienka "Paste your sequences" v stranke Yass-u a dvakrat stlacte tlacidlo Select vedla okienka
    • Nizsie v casti "Selected DNA sequence(s)" by sa Vam malo v oboch riadkoch objavit "Pasted file 1"
    • Nizsie v casti "Parameters" zvolte "E-value threshold" 0.01 a stlacte "Run YASS"
    • Vo vysledkoch si pozrite Dotplot, co z neho viete usudit o podobnosti jednotlivych casti Alu opakovania?
    • Vo vysledkoch si pozrite Raw: blast, ake su suradnice opakujucej sa casti a kolko zarovnanie obsahuje zhod/nezhod/medzier? (Pozor, prve zarovnanie je cela sekvencia sama k sebe, druhe je asi to, co chcete)
  • V genome browseri zadajte poziciu chr21:9,440,000-9,450,000 (10kb sekvencie na chromozome 21, s niekolkymi vyskytmi Alu)
  • Chceme teraz porovnat tento usek genomu so sekvenciou Alu pomocou YASSu
    • Ako predtym si stiahnite DNA sekvenciu tohto useku
    • V YASSe chodte sipkou spat na formular
    • Skopirujte DNA sekvenciu do YASSoveho formulara, do okienka vpravo (vyznacit si ju mozete klavesovou kombinaciou Ctrl-A alebo Select All v menu Edit),
    • V casti formulara Selected DNA sequence(s) stlacte Remove pri hornom riadku
    • Pri pravom okienku, kam ste nakopirovali sekvenciu, stlacte Select
    • Zase stlacte Run YASS
    • Pozrite si vysledok ako Dotplot, kolko opakovani Alu ste nasli? Preco je jedno cervene?
    • Pozrite si Raw: blast, na kolko percent sa podoba najpodobnejsia a na kolko druha najpodobnejsia kopia?

Fylogeneticke stromy

  • Terminologia: zakoreneny/nezakoreneny strom, hrana, vrchol, list, vnutorny vrchol, koren
  • Ak mame zakoreneny strom s n listami a kazdy vnutorny vrchol ma 2 deti, bude mat n-1 vnutornych vrcholov (preco?)
  • V nezakorenenom strome s n listami, ak ma kazdy vrchol 3 susedov, bude mat n-2 vnutornych vrcholov
  • Kolkymi sposobmi mozeme zakorenit nezakoreneny strom?
  • Ak nakreslime zakoreneny strom obvyklym sposobom, listy su usporiadane zhora nadol. Kolko roznych poradi listov vieme dostat roznym zakreslovanim toho isteho stromu? Kolko je vobec roznych poradi listov, ak neberieme do uvahy strom?
  • Co vieme zistit o pribuznosti organizmov z nezakoreneneho stromu (napr. kvartet 4 organizmov)?
  • Ine pouzitie stromov v informatike: uvidime hierarchicke zhlukovanie, bayesovske siete, ale tiez efektivne datove struktury

Bootstrap

  • Nahodne vyberieme niektore stlpce zarovnania, zostrojime strom vybranou metodou
  • Cele to opakujeme vela krat
  • Znacime si, kolkokrat sa ktora vetva opakuje v stromoch, ktore dostavame
    • Pri nezakoreneneych stromoch je vetva rozdelenie listov na dve skupiny
  • Nakoniec zostavime strom z celych dat a pozrieme sa ako casto sa ktora jeho vetva vyskytovala
    • Mozeme zostavit aj strom casto sa vyskytujucich hran (napr tych, ktore su vo viac ako 50% stromov)
  • Bootstrap hodnoty nam daju urcity odhad spolahlivosti, hlavne ak mame celkovo malo dat (kratke zarovnanie)
  • Ak vsak data velmi dobre nezodpovedaju vybranej metode tak aj pre zly strom mozeme dostat vysoky bootstrap

Priklad

Bootstrap.png
  • Robili sme 100x bootstrap, 40x sme dostali strom (i) na obrazku, 40x sme dostali strom (ii) a 20x sme dostali strom (iii)
  • Strom (iii) sme dostali aj spustenim metody na celych datach
  • Zistite uroven bootstrap podpory pre jednotlive vetvy stromu (iii)
  • Ktore dalsie biparticie maju podporu aspon 20%?
  • Aky strom by sme dostali, ak by sme chceli nechat iba vetvy s podporou aspon 80%?

Prakticka ukazka tvorby stromov

  • V UCSC browseri mozeme ziskavat viacnasobne zarovnania jednotlivych genov (nukleotidy alebo proteiny). Nasledujuci postup nemusite robit, subor si stiahnite tu: http://compbio.fmph.uniba.sk/vyuka/mbi/poznamky/cb06/cb06-aln.fa
    • UCSC browseri si pozrieme usek ludskeho genomu chr6:136,214,527-136,558,402 s genom PDE7B (phosphodiesterase 7B)
    • Na modrej liste zvolime Tools, Table browser. V nastaveniach tabuliek Track: RefSeq genes, zaklikneme Region: position, a Output fomat: CDS FASTA alignment a stlacime Get output
    • Na dalsej obrazovke zaklikneme show nucleotides. Z primatov zvolime chimp, rhesus, tarsier, z inych cicavcov mouse, rat, dog, elephant a z dalsich organizmov opposum, platypus, chicken, lizard, stlacime Get output.
    • Vystup ulozime do suboru, nechame si iba prvu formu genu, z mien sekvencii zmazeme spolocny prefix NM_018945_, pripadne celkovo prepiseme mena na anglicke nazvy,
  • Skusme zostavit strom na stranke http://mobyle.pasteur.fr/cgi-bin/portal.py
  • Pouzijeme program quicktree, metodu neighbor joining, bootstrap 100
  • Na zobrazenie stromu vysledok dalej prezenieme cez zobrazovacie programy drawtree alebo newicktops (zvolit v menu pri tlacidle further analysis)
    • Vysledok z drawtree, nezakoreneny, nezobrazuje bootstrap hodnoty
    • Vysledok z newicktops, zakoreneny na nahodnom mieste (nie spravne) zobrazuje bootstrap hodnoty
    • v drawtree sme nastavili sme formát výstupu MS-Windows Bitmap a X,Y resolution aspoň 1000, v newicktops sme nastavili show bootstrap values
  • "Spravny strom" [5] v nastaveniach Conservation track-u v UCSC browseri (podla clanku Murphy WJ, Eizirik E, O'Brien SJ, Madsen O, Scally M, Douady CJ, Teeling E, Ryder OA, Stanhope MJ, de Jong WW, Springer MS. Resolution of the early placental mammal radiation using Bayesian phylogenetics. Science. 2001 Dec 14;294(5550):2348-51.)
  • Nas strom ma long branch attraction (zle postavenie hlodavcov, ktori maju dlhu vetvu aj slona, co moze byt zapricene sekvenovacimi chybami).
  • Ine programy, ktore mozete skusit na mobyle
    • phyml: metoda maximalnej vierohodnosti (daju sa nastavit detaily modelu, bootstraps, ktory ale moze dost dlho trvat, typy operacii na strome pri heuristickom hladani najlepsieho stromu)
    • dnapars alebo protpars na parsimony
    • viacnasobne zarovnanie pomocou clustalw alebo modernejsou alternativou muscle
    • Ak chcete skusat zarovnania, zacnite z nezarovnanych sekvencii: http://compbio.fmph.uniba.sk/vyuka/mbi/poznamky/cb06/cb06-seq.fa

HMM, cvičenia pre informatikov

Substitucne matice opakovanie

  • S(t): matica 4x4, kde policko S(t)_{{a,b}}=P(b|a,t) je pravdepodobnost, ze ak zacneme s bazou a, tak po case t budeme mat bazu b.
  • Jukes-Cantorov model predpoklada, ze tato pravdepodobnost je rovnaka pre kazde dve bazy a\neq b
  • Pre dany cas t mame teda vsade mimo diagonaly s(t) a na diagonale 1-3s(t)
  • Matica rychlosti R: pre Jukes-Cantorov model vsade mimo diagonaly \alpha , na diagonale -3\alpha
  • Pre velmi maly cas t je S(t) zhruba I-Rt
  • Rychlost alpha je teda pravdepodobnost zmeny za jednotku casu, ak uvazujeme velmi kratke casy alebo derivacia prvku s(t) vzhladom na t v bode 0
  • Riesenim diferencialnych rovnic pre Jukes-Cantorov model dostavame s(t)=(1-e^{{-4\alpha t}})/4
  • Matica rychlosti sa zvykne normalizovat tak, aby na jednotku casu pripadla v priemere jedna substitucia, co dosiahneme ak \alpha =1/3

Zložitejšie modely

V praxi sa používajú komplikovanejsie substitucne modely, ktore maju vseobecnejsiu maticu rychlosti R

  • \mu =\left({\begin{array}{cccc}.&\mu _{{AC}}&\mu _{{AG}}&\mu _{{AT}}\\\mu _{{CA}}&.&\mu _{{CG}}&\mu _{{CT}}\\\mu _{{GA}}&\mu _{{GC}}&.&\mu _{{GT}}\\\mu _{{TA}}&\mu _{{TC}}&\mu _{{TG}}&.\\\end{array}}\right)

Hodnoty na diagonále matice sa dopočítavajú aby sucet kazdeho riadku bol 0.

  • Hodnota \mu _{{xy}} v tejto matici vyjadruje rýchlosť, akou sa určitá báza x mení na inú bázu y.
  • Presnejsie \mu _{{xy}}=\lim _{{t\rightarrow 0}}{\frac  {\Pr(y\,|\,x,t)}{t}}.

Kimurov model napr. zachytava, ze puriny sa castejsie menia na ine puriny (A a G) a pyrimidiny na ine pyrimidiny (C a T).

  • Ma dva parametre: rychlost tranzicii beta, tranzverii alfa
R=\left({\begin{array}{cccc}-2\beta -\alpha &\beta &\alpha &\beta \\\beta &-2\beta -\alpha &\beta &\alpha \\\alpha &\beta &-2\beta -\alpha &\beta \\\beta &\alpha &\beta &-2\beta -\alpha \\\end{array}}\right)
  • HKY model (Hasegawa, Kishino & Yano) tiez umoznuje rozne pravdepodobnosti A, C, G a T v ekvilibriu.
  • Ak nastavíme čas v evolučnom modeli na nekonečno, nezáleží na tom, z ktorej bázy sme začali, frekvencia výskytu jednotlivých báz sa ustáli v tzv. ekvilibriu.
  • V Jukes-Cantorovom modeli je pravdepodobnosť ľubovoľnej bázy v ekvilibriu 1/4.
  • V HKY si zvolime aj frekvencie jednotlivých nukleotidov v ekvilibriu \pi _{A},\pi _{C},\pi _{G},\pi _{T} so suctom 1
  • Parameter kapa: pomer tranzicii a transverzii (beta/alfa)
  • Matica rychlosti:
    • \mu _{{x,y}}=\kappa \pi _{y} ak mutácia x->y je tranzícia,
    • \pi _{y} ak mutácia x->y je transverzia
  • Pre zlozite modely nevieme odvodit explicitny vzorec na vypocet S(t), ako sme mali pri Jukes-Cantorovom modeli
  • Ale vo vseobecnosti pre maticu rychlosti R dostavame S(t)=e^{{Rt}}.
    • Exponencialna funkcia matice A sa definuje ako e^{A}=\sum _{{k=0}}^{\infty }{1 \over k!}A^{k}.
    • Ak maticu rychlosti R diagonalizujeme (urcite sa da pre symetricke R) R=UDU^{{-1}}, kde D je diagonalna matica (na jej diagonale budu vlastne hodnoty R), tak e^{{Rt}}=Ue^{{Dt}}U^{{-1}}, t.j. exponencialnu funkciu uplatnime iba na prvky na uhlopriecke matice D.

HMM opakovanie

Parametre HMM:

  • a_{{u,v}}: prechodová pravdepodobnosť zo stavu u do stavu v
  • e_{{u,x}}: pravdepodobnosť emisie x v stave u
  • \pi _{{u}}: pravdepodobnosť, že začneme v stave u


  • Sekvencia S=S_{1}S_{2}\dots S_{n}
  • Anotácia A=A_{1}A_{2}\dots A_{n}

Pr(S,A)=\pi _{{A_{1}}}e_{{A_{1},S_{1}}}\prod _{{i=2}}^{n}a_{{A_{{i-1,A_{i}}}}}e_{{A_{i},S_{i}}}

Trénovanie

Proces, pri ktorom sa snažíme čo najlepšie odhadnúť pravdepodobnosti a_{{u,v}} a e_{{u,x}} v modeli podľa trénovacích dát

Usudzovanie (inferencia)

Proces, pri ktorom sa snažíme pre sekvenciu S nájsť anotáciu A, ktorá sekvenciu S emituje s veľkou pravdepodobnosťou.

Inferencia pomocou najpravdepodobnejšej cesty, Viterbiho algoritmus

Hľadáme najpravdepodobnejšiu postupnosť stavov A, teda \arg \max _{A}\Pr(A,S). Úlohu budeme riešiť dynamickým programovaním.

  • Podproblém V[i,u]: Pravdepodobnosť najpravdepodobnejšej cesty končiacej po i krokoch v stave u, pričom vygeneruje S_{1}S_{2}\dots S_{i}.
  • Rekurencia:
    • V[1,u]=\pi _{u}e_{{u,S_{1}}} (*)
    • V[i,u]=\max _{w}V[i-1,w]a_{{w,u}}e_{{u,S_{i}}} (**)

Algoritmus:

  1. Nainicializuj V[1,*] podľa (*)
  2. for i=2 to n=dĺžka reťazca
for u=1 to m=počet stavov
vypočítaj V[i,u] pomocou (**)
  1. Maximálne V[n,j] je pravdepodobnosť najpravdepodobnejšej cesty

Aby sme vypísali anotáciu, pamätáme si pre každé V[i,u] stav w, ktorý viedol k maximálnej hodnote vo vzorci (**).

Zložitosť: O(nm^{2})

Poznámka: pre dlhé sekvencie budú čísla V[i,u] veľmi malé a môže dôjsť k podtečeniu. V praxi teda používame zlogarimované hodnoty, namiesto násobenia súčet.

Inferencia - dopredný algoritmus

Aká je celková pravdepodobnosť, že vygenerujeme sekvenciu S, t.j. \sum _{A}Pr(A,S). Podobný algoritmus ako Viterbiho.

Podproblém F[i,u]: pravdepodobnosť, že po i krokoch vygenerujeme S_{1},S_{2},\dots S_{i} a dostaneme sa do stavu u.

F[i,u]=\Pr(A_{i}=u\wedge S_{1},S_{2},\dots ,S_{i})=\sum _{{A_{1},A_{2},\dots ,A_{i}=u}}\Pr(A_{1},A_{2},...,A_{i}\wedge S_{1},S_{2},...,S_{i})

F[1,u]=\pi _{u}e_{{u,S_{1}}}

F[i,u]=\sum _{v}F[i-1,v]a_{{v,u}}e_{{u,S_{i}}}

Celková pravdepodobnosť \sum _{u}F[n,u]

Evolúcia, cvičenia pre biológov

Fitchov algoritmus

Fitch.png
  • Parsimony/uspornost
    • Vstup: fylogeneticky strom, 1 stlpec zarovnania (jedna baza v kazdom liste stromu)
    • Vystup: priradenie baz predkom minimalizujuce pocet substitucii
  • Priklad - obr 1
  • Uvazujme, co vieme povedat o strome s dvoma susednymi listami vo vacsom strome (oznacenie: obr. 2, listy v1 a v2, hrany do listov e1, e2, ich predok v3, hrana z v3 vyssie e3).
  • Ak oba listy maju bazu rovanku bazu, napr. A, predok v3 v optimalnom rieseni bude urcite mat bazu A
    • Dokaz sporom: nech to tak nie je, nech optimalne riesenie ma nejaku inu bazu, napr. C. Vymenme v tomto rieseni toto C za A. Moze nam pribudnut jedna mutacia na hrane e3, ale ubudnu dve na hranach e1 a e2. Tym celkova cena riesenia klesne o 1, takze nebolo optimalne.
  • Ak tieto dva listy maju rozne bazy, napr. A a C, tak existuje optimalne riesenie, ktore ma v predkovi v3 bazu A alebo C.
    • Dokaz: vezmime optimalne riesenie. Ak ma v3 bazu A alebo C, tvrdenie plati. Ak ma v3 nejaku inu bazu, napr T, mozeme ju vymenit napr. za A, ci mozno pribudne jedna mutacia na e3 ale urcite ubudne mutacia na e1. Teda celkovy pocet mutacii sa nezvysi a nase nove riesenie je stale optimalne. Pozor, vo vseobecnosti nevieme povedat, ci ma v3 mat bazu A alebo C. V niektorych pripadoch su optimalne obe, v niektorych len jedna z nich.
  • Fitchov algoritmus 1971
  • Kazdemu vrcholu v priradime mnozinu baz M(v)
  • M(v) pocitame od listov smerom ku korenu
  • Pre list v bude M(v) obsahovat bazu v tomto liste
  • Uvazujme vnutorny vrchol v s detmi x a y. Mame uz spocitane M(x) a M(y), chceme M(v)
  • Ak M(x) a M(y) maju nejake spolocne bazy, vsetky tieto spolocne bazy dame do M(v), t.j. M(v)=M(x)\cap M(y)
  • Ak M(x) a M(y) nemaju spolocne bazy, do M(v) dame vsetky bazy z M(x) aj M(v), t.j. M(v)=M(x)\cup M(y)
V tomto pripade pocet mutacii vzrastie o jedna
  • Ked mame M(v) spocitane pre vsetky vrcholy, ideme od korena smerom k listom a vyberieme vzdy jednu bazu z M(v).
  • Ak sme vybrali pre rodica bazu x a x je v M(v), zvolime x aj pre v, inak zvolime lubovolnu bazu z M(v).
  • Priklad algoritmu na obr 3

Opakovanie pravdepodobnostnych modelov

Ake sme doteraz videli modely

  • E-value v BLASTe: nahodne vygenerujeme databazu a dotaz (query), kolko bude v priemere medzi nimi lokalnych zarovnani so skore aspon T?
  • Hladanie genov: model generujuci sekvenciu+anotaciu naraz (parametre nastavene na znamych genoch). Pre danu sekvenciu, ktora anotacia je najpravdepodobnejsia?
  • Evolucia, Jukes-Cantorov model: model generujuci stlpec zarovnania. Nezname parametre: strom, dlzky hran. Pre danu sadu stlpcov zarovnania, ktore parametre povedu k najvacsej pravdepodobnosti? \max _{{param}}\Pr(data|param)
  • Trochu detailov: pravdepodobnost zmeny/nezmeny na hrane dlzky t: P(A|A,t)=(1+3e^{{-{\frac  {4}{3}}t}})/4, P(C|A,t)=(1-e^{{-{\frac  {4}{3}}t}})/4
  • Ak pozname ancestralne sekvencie, vieme spocitat pravdepodobnost dat
  • Ancestralne sekvencie su nahodne premenne, ktore nas nezaujimaju: marginalizujeme ich (uvazujeme vsetky ich mozne hodnoty)

Zlozitejsie evolucne modely

  • Jukes-Cantorov model uvazuje len dlzku hrany udanu ako priemerny pocet substitucii (vratane tych, ktore nevidime, kvoli tomu, ze su dve na tom istom mieste)
  • Nie vsetky substitucie sa deju rovnako casto: tranzicie (v ramci pyrimidinov T<->C, v ramci purinov A<->G) su pravdepodobnjesie ako transverzie (A,G)<->(C,T)
  • Nie vsekty nukleotidy sa v danom genome objavuju rovnako casto (napr. mitochondrialne genomy velmi male C,G)
  • Tieto javy zachytava HKY model (Hasegawa, Kishino & Yano)
  • Matica rychlosti (rate matrix)

\left({\begin{array}{cccc}-\mu _{A}&\beta \pi _{C}&\alpha \pi _{G}&\beta \pi _{T}\\\beta \pi _{A}&-\mu _{C}&\beta \pi _{G}&\alpha \pi _{T}\\\alpha \pi _{A}&\beta \pi _{C}&-\mu _{G}&\beta \pi _{T}\\\beta \pi _{A}&\alpha \pi _{C}&\beta \pi _{G}&-\mu _{T}\\\end{array}}\right)

  • \kappa =\alpha /\beta je pomer rychlosti, ktorymi sa deju tranzicie vs. transverzie
  • \pi _{j} je frekvencia bazy j v sekvencii
  • Rychlost, ako sa deje substitucia z X do Y je sucin pravdepodobnosti Y a faktoru, ktory zavisi od toho, ci ide o tranziciu alebo transverziu
  • Sucet kazdeho stlpca matice ma byt 0, t.j. \mu _{A}=\beta \pi _{A}+\alpha \pi _{A}+\beta \pi _{A}
  • Matica sa znormalizuje tak, aby priemerny pocet substitucii za jednotku casu bol 1
  • Matica ma styri parametre: \kappa a tri frekvencie (stvrta musi doplnit do 1) plus dlzka hrany
  • Zlozitejsi model lepsie zodpoveda skutocnym procesom, ale na odhad viac parametrov potrebujeme viacej dat.
  • Existuju metody, ktore pre dany cas t z matice rychlosti spocitaju pravdepodobnost, ze baza X zmutuje na bazu Y Pr(Y|X,t)
  • Napr. pre velmi velmi maly cas \epsilon mame \Pr(C|A,\epsilon ) je zhruba \epsilon \beta \pi _{C}
  • Pre rozumne dlhe casy toto neplati, preto sa pouzivaju algebraicke metody, ktore beru do uvahy moznost viacerych substitucii na tom istom mieste
  • Je aj vela inych modelov s mensim alebo vacsim poctom parametrov

Príklady stavových automatov pre HMM

Uvazujme HMM so specialnym zaciatocnym stavom b a koncovym stavom e, ktore nic negeneruju.

  • Nakreslite HMM (stavovy diagram), ktory generuje sekvencie, ktore zacinaju niekolkymi cervenymi pismenami a potom obsahuju niekolko modrych
  • Ako treba zmenit HMM, aby dovoloval ako "niekolko" aj nula?
  • Ako treba zmenit HMM, aby pocet cervenych aj modrych bol vzdy parne cislo?
  • Ako zmenit HMM, aby sa striedali cervene a modre kusy parnej dlzky?

V dalsich prikladoch uvazujeme aj to, ktore pismena su v ktorom stave povolene (pravdepodobnost emisie > 0) a ktore su zakazane

  • cervena sekvencia dlzky dva, ktora zacina na A
  • cervena sekvencia dlzky dva, ktora je hocico okrem AA
  • toto sa da rozsirit na HMM, ktory reprezentuje ORF, teda nieco, co zacina start kodonom, potom niekolko beznych kodonov, ktore nie su stop kodonom a na koniec stop kodon

Dalsi biologicky priklad HMM: topologia transmembranovych proteinov.

HMM 2, cvičenia pre informatikov

Pokracovanie temy z HMM, cvičenia pre informatikov, dalsie algoritmy a rozsirenie na fylogeneticke HMM

Opakovanie:

  • HMM
  • Viterbiho algoritmus

Fylogenetické HMM

  • Spojenie HMM a fylogenetickeho stromu
  • Dana topologia stromu T
  • Konecna mnozina stavov
  • a_{{u,v}}: prechodová pravdepodobnosť zo stavu u do stavu v
  • \pi _{{u}}: pravdepodobnosť, že začneme v stave u
  • Namiesto emisnej pravdepodobnosti mame pre kazdy stav u maticu rychlosti R_{u}

Priklad:

  • PhastCons: 2 stavy: zachovana a nezachovana sekvencia
  • Komparativne hladanie genov

Opakovanie: Viterbiho algoritmus pre HMM

  • Podproblém V[i,u]: Pravdepodobnosť najpravdepodobnejšej cesty končiacej po i krokoch v stave u, pričom vygeneruje S_{1}S_{2}\dots S_{i}.
  • V[i,u]=\max _{v}V[i-1,v]a_{{v,u}}e_{{u,x_{i}}}

Modifikacia pre fylogeneticke HMM:

  • Pre kazdy stlpec zarovnania S_{i} a stav u spustime Felsensteinov algoritmus s maticou rychlosti R_{u}
    • Spocita pravdepodobnost P(S_{i}|R_{u})
  • Vyslednu pravdepodobnost pouzijeme namiesto e_{{u,S_{i}}}
  • Zlozitost pre k stavov, dlzku zarovnania n, pocet organizmov m: O(nmk + nk^2)

Inferencia - posterior decoding

Vratme sa k obycajnym HMM. Opakovanie: dopredny algoritmus z minulych cviceni

Aposteriórna pravdepodobnosť stavu u na pozícii i: Pr(A_{i}=u|S_{1}\dots S_{n})

Pre každý index i chceme nájsť stav u s najväčšiou aposteriórnou pravdepodobnosťou, dostaneme tak inú možnú anotáciu.

Spustíme dopredný algoritmus a jeho symetrickú verziu, spätný algoritmus, ktorý počíta hodnoty B[i,u]=\Pr(A_{i}=u\wedge S_{{i+1}}\dots S_{n})

Aposteriórna pravdepodobnosť stavu u na pozícii i: Pr(A_{i}=u|S_{1}\dots S_{n})=F[i,u]B[i,u]/\sum _{u}F[n,u].

Posterior decoding uvažuje všetky anotácie, nielen jednu s najvyššou pravdepodobnosťou. Môže však vypísať anotáciu, ktorá má sama o sebe nulovú pravdepodobnosť (napr. počet kódujúcich báz v géne nie je deliteľný 3).

Trénovanie HMM

  • Stavový priestor + povolené prechody väčšinou ručne
  • Parametre (pravdepodobnosti prechodu, emisie a počiatočné) automaticky z trénovacích sekvencií
    • Ak máme anotované trénovacie sekvencie, jednoducho počítame frekvencie
    • Ak máme iba neanotované sekvencie, snažíme sa maximalizovať vierohodnosť trénovacích dát v modeli. Používajú sa heuristické iteratívne algoritmy, napr. Baum-Welchov, ktorý je verziou všeobecnejšieho algoritmu EM (expectation maximization).
  • Čím zložitejší model a viac parametrov máme, tým potrebujeme viac trénovacích dát, aby nedošlo k preučeniu, t.j. k situácii, keď model dobre zodpovedá nejakým zvláštnostiam trénovacích dát, nie však ďalším dátam.
  • Presnosť modelu testujeme na zvláštnych testovacích dátach, ktoré sme nepoužili na trénovanie.

Tvorba stavového priestoru modelu

  • Promótor + niekoľko prokaryotických génov
  • Repeaty v intrónoch: multiple path problem
  • Intrón má dĺžku aspoň 10

Zovšeobecnené HMM

  • Problém s modelovaním rozdelenia dĺžok - v základnom modeli je geometrické
  • Zovseobecnene HMM v jednom stave vygenerujú viac znakov
  • Viterbi alg. a spol budú pomalšie (kvadratické od dĺžky sekvencie)

Parove HMM

Nebrali sme, uvedene pre zaujimavost

  • Emituje dve sekvencie
  • V jednom kroku moze emitovat:
    • pismenka v oboch sekvenciach naraz
    • pismenko v jednej skevencii
    • pismenko v druhej sekvencii

Priklad: HMM s jednym stavom v, takym, ze

  • e_{{v,x,x}}=p_{1}
  • e_{{v,x,y}}=p_{2}(x\neq y),
  • e_{{v,x,-}}=p_{3},
  • e_{{v,-,x}}=p_{3}
  • tak, aby sucet emisnych pravdepodobnosti bol 1
  • Co reprezentuje najpravdepodobnejsia cesta v tomto HMM?

Zlozitejsi HMM: tri stavy M, X, Y, uplne navzajom poprepajane

  • e_{{M,x,x}}=p_{1}
  • e_{{M,x,y}}=p_{2}(x\neq y),
  • e_{{X,x,-}}=1/4,
  • e_{{Y,-,y}}=1/4,
  • Co reprezentuje najpravdepodobnejsia cesta v tomto HMM?

Viterbiho algoritmus pre parove HMM

  • V[i,j,u] = pravdepodobnost najpravdepodobnejsej postupnosti stavov, ktora vygeneruje x1..xi a y1..yj a skonci v stave u
  • V[i,j,u]=\max _{w}\left\{{\begin{array}{l}V[i-1,j-1,w]\cdot a_{{w,u}}\cdot e_{{u,x_{i},y_{j}}}\\V[i-1,j,w]\cdot a_{{w,u}}\cdot e_{{u,x_{i},-}}\\V[i,j-1,w]\cdot a_{{w,u}}\cdot e_{{u,-,y_{j}}}\\\end{array}}\right.
  • Casova zlozitost O(mnk^2) kde m a n su dlzky vstupnych sekvencii, k je pocet stavov


Ako by sme spravili parove HMM na hladanie genov v dvoch sekvenciach naraz?

  • Predpokladajme rovnaky pocet exonov
  • V exonoch medzery len cele kodony (oboje zjednodusuje)
  • Inde hocijake medzery

Hľadanie génov a komparatívna genomika, cvičenia pre biológov

  • Pozri slidy [6]

Hľadanie génov v prokaryotických genómoch

  • ORF: open reading frame, jednoduche hladanie
  • ako najst zaciatok, ako rozlisit psedogeny a nahodne ORF-y
  • samotrenujuce sa HMM, codon bias, GC%

E. coli http://nar.oxfordjournals.org/content/34/1/1.full

  • Prvykrat sekvenovana a anotovana 1997
  • Porovnanie s verziou 2005 (oprava sekvenovacích chýb aj chýb v anotácii)
    • 682 zmien v start kodone
    • 31 génov zrušených
    • 48 nových génov
    • Celkovo asi 4464 génov

Programy na anotovanie prokaryotických genómov

  • ORFfinder at NCBI [7]
  • Glimmer at NCBI [8]
  • GeneMark at NCBI [9]
  • tRNAscan-SE [10]

Histónové modifikácie

  • A. Barski, S. Cuddapah, K. Cui, T. Roh, D. Schones, Z. Wang, G. Wei, I. Chepelev, K. Zhao (2007) High-Resolution Profiling of Histone Methylations in the Human Genome Cell, Volume 129, Issue 4, Pages 823-837 pdf

Gény v ľudskom genóme

  • What is a gene, post-ENCODE? History and updated definition. Gerstein MB, Bruce C, Rozowsky JS, Zheng D, Du J, Korbel JO, Emanuelsson O, Zhang ZD, Weissman S, Snyder M.
  • Most "dark matter" transcripts are associated with known genes. H Van Bakel, C Nislow, BJ Blencowe, TR Hughes - PLoS Biol, 2010
  • Transcribed dark matter: meaning or myth? CP Ponting, TG Belgard - Human molecular genetics, 2010
  • Landscape of transcription in human cells. Djebali et al (ENCODE), Nature 2012

Gény, evolúcia a komparatívna genomika v UCSC genome browseri

  • Na stránke http://genome.ucsc.edu/ zvolíme staršiu verziu ľudského genómu hg18, ktorá ma viac informacií, nájdeme gén MAGEA2B na pozícii cca chrX:151636040-151637735 (má dva výskyty)
    • Dostanete sa tam aj touto linkou: [11]
  • Ak dáte 3x zoom out, môžete si všimnúť, že tento gén má viacero foriem zostrihu, ktoré sa ale líšia iba v 5' UTR
  • Všimnite si ENCODE Regulation Super-track, ktorý zobrazuje ChIP data pre niektoré histónove modifikácie
  • Veľa vecí sa môžete dozvedieť klikaním na rôzne časti broswera: napr. kliknutím na gén si môžete prečítať o jeho funkcii, kliknutím na lištu ku tracku (ľavý okraj obrázku) sa dozviete viac o tracku a môžete nastavovať parametre zobrazenia


  • V casti Genes and Gene Prediction Tracks zapnite track Pos Sel Genes, ktory obsahuje geny s pozitivnym vyberom (cervenou, pripadne slabsie fialovou a modrou)
  • Ked kliknete na cerveny obdlznik pre tento gen, uvidite, v ktorych castiach fylogenetickeho stromu bol detegovany pozitivny vyber
  • V casti multiz alignments tracku Conservation vidite zarovnania k roznym inym genomom (da sa zapinat, ze ku ktorym). Mozete si pozriet, ako sa uroven zarovnania zmeni ked sa priblizujeme a vzdalujeme (zoom in/zoom out).
  • Ked sa priblizite spat na gen MAGEA2B a potom tak, aby ste boli na urovni "base", t.j. zobrazenych cca 100bp, v obdlzniku multiz alignment uvidite zarovnanie s homologickym usekom v inych genomoch. Konkretne v MAGEA2B vidime pomerne dost rozdielov v proteine medzi clovekom a makakom rezus, vdaka ktorym bol zrejme klasifikovany ako pod pozitivnym vyberom.
  • V casti conservation by PhyloP vidime graf toho, ako silne su zachovane jednotlive stlpce zarovnania
  • Da sa zapnut aj track 28-Way Most Cons, ktory zobrazuje konkretne useky, ktore su najvac konzervovane
    • Ak chceme zistit, kolko percent genomu tieto useky pokryvaju, ideme na modrej liste do casti Tools->Table browser, zvolime group Comparative genomics, track 28-way most cons, table Mammal alebo Vertebrate, region zvolime genome (v celom genome) a stlacime tlacidlo Summary/statistics

Objavenie génu HAR1 pomocou komparatívnej genomiky

  • Pollard KS, Salama SR, Lambert N, et al. (September 2006). "An RNA gene expressed during cortical development evolved rapidly in humans". Nature 443 (7108): 167–72. doi:10.1038/nature05113. PMID 16915236. pdf
  • Zobrali všetky regióny dĺžky aspoň 100bp s > 96% podobnosťou medzi šimpanzom a myšou/potkanom (35,000)
  • Porovnali s ostatnými cicavcami, zistili, ktoré majú veľa mutáci v človeku, ale málo inde (pravdepodobnostný model)
  • 49 štatisticky významných regiónov, 96% nekódujúcich oblastiach
  • Najvýznamnejší HAR1: 118nt, 18 substitúcii u človeka, očakávali by sme 0.27. Iba 2 zmeny medzi šimpanzom a sliepkou (310 miliónov rokov), ale nebol nájdený v rybách a žabe.
  • Nezdá sa byť polymorfný u človeka
  • Prekrývajúce sa RNA gény HAR1R a HAR1F
  • HAR1F je exprimovaný v neokortexe u 7 a 9 týždenných embrií, neskôr aj v iných častiach mozgu (u človeka aj iných primátov)
  • Všetky substitúcie v človeku A/T->C/G, stabilnejšia RNA štruktúra (ale tiež sú blízko k telomére, kde je viacej takýchto mutácii kvôli rekombinácii a biased gene conversion)
  • Môžete si pozrieť tento region v browseri: chr20:61,203,911-61,204,071 (hg18), pricom ak sa este priblizite, uvidite zarovnanie aj s bazami a mozete vidiet, ze vela zmien je specifickych pre cloveka
  • Vynimkou je slon, niektore zmeny v slonovi su sposobene nizkou kvalitou sekvencie. Ked pomocou nastroja In other genomes (convert) v polozke View na hornej liste premapujete do najnovsej verzie ludskeho genomu (hg19), uvidite, ze aj v najnovsej verzii genomu slona su mnohe zmeny, nechyba tam uz vsak cast sekvencie, ako vo verzii pouzitej v hg18.

Expresia génov, cvičenia pre informatikov

Zhlukovanie (clustering)

Príklad dvoch zhlukov

Využitie:

  • taggovanie nových príspevkov na blogu pomocou taggov príspektov, s ktorými je nový príspevok v zhluku
  • news.google.com - zhlukovanie správ podľa spoločnej témy
  • počítačová grafika
    • segmentácia obrázkov - rozdelenie obrázka na "rozumné" časti
    • zníženie počet farieb
  • výpočtová biológia - funkčné skupiny génov
  • detekcia anomálií - napr. testovanie motorov do lietadiel (predpokladám, že väčšina vyrobených motorov je dobrá, na základe meraní motory pozhlukujem a tie mimo hlavného vyhlásim za potencionálne závadné)


K-Means

Znázornenie vzdialenosti bodov od príslušných centroidov
Vstup: Body x_{1},x_{2},...,x_{t},{\mbox{ kde }}(x_{i}\in R^{n}) a počet zhlukov k
Výstup: Rozdelenie do k zhlukov takéto:
c_{1},c_{2},...,c_{t}\;(1\leq c_{i}\leq k) - priradenie bodu k zhluku
\mu _{1},\mu _{2},...,\mu _{k}\;(\mu _{i}\in R^{n}) - centrá každého zhluku centroidy


Úloha: minimalizovať chybovú funkciu J(\mu ,c)=\sum _{{i=1}}^{k}\sum _{{j:c_{j}=i}}{\big \|}x_{j}-\mu _{i}{\big \|}_{2}^{2} (inými slovami, počítam ako ďaleko (Euklidovská vzdialenosť) je každý bod od svojho centroidu?)

Algoritmus

  1. inicializácia: náhodne vyber k centroidov \ \mu _{1},\mu _{2},...,\mu _{k}
  2. opakuj až do konvergencie:
    priraď každý bod najbližšiemu centroidu: c_{i}=\operatorname {arg_{j}\,min}{\big \|}x_{i}-\mu _{j}{\big \|}_{2}
    vypočítaj nové centroidy: \mu _{j}=\operatorname {avg_{{i:c_{i}=j}}}x_{i} (spriemerujem všetky body v jednom zhluku)


Hladanie motivov zadefinovanych pravdepodobnostnou maticou

  • Mame danych n sekvencii S=(S1..Sn), kazda dlzky m, dlzku motivu L, nulova hypoteza q (rozdelenie nukleotidov)
  • Hladame motiv vo forme pravdepodobnostneho profilu dlzky L a jeho vyskyt v kazdej sekvencii
  • Nech w_{{a,i}} je pravdepodobnost, ze na pozicii i motivu bude baza a, W cela matica (na prednaske matica M)
  • o_i je pozicia vyskytu v sekvencii S_i, O=(o_1...o_n) su vsetky vyskyty dokopy
  • Pr(S|W.O) je jednoduchy sucin, kde pre pozicie v oknach pouzijeme pravdepodobnosti z W, pre pozicie mimo okna pouzijeme q
  • Hladame W,O, ktore maximalizuju tuto pravdepodobnost (najvierhododnejsie)
    • Nepozname efektivny algoritmus, ktory by to vedel vzdy najst maximum
    • Dali by sa skusat vsetky moznosti O, pre dane O je najlepsie W frekvencie z dat
    • Naopak ak pozname W, vieme najst najlepsie O
    • EM algoritmus: iterativne zlepsuje W, pricom berie vsetky O vahovane podla ich pravdepodohnosti vzhladom na W z minuleho kola
    • Vudeli sme na prednaske
  • Casto sa v zlozitych pravdepdobnostnych modeloch pouziva namiesto optimalizacie parametrov vzorkovanie (sampling)
    • Rozsirime model, aby aj O a W boli nahodne premenne, takze mame rozdelenie Pr(S,W,O)
    • Vzorkujeme z Pr(O|S)
    • Mozeme pre kazdu vzorku spocitat Pr(S|W,O) a zobrat najlepsiu
    • Alebo si mozeme si pamatat, ktore okno ako casto vnutri motivu, robit priemery roznych velicin, skumat tvar rozdelenia
    • My pouzijeme metodu Markov chain Monte Carlo (MCMC) a konkretne jej variant Gibbsovo vzorkovanie (Gibbs sampling)

Hladanie motivov pomocou Gibbsovho vzorkovania

Zadefinujeme cele ako velky pravdepodobnostny model:

  • vygeneruje sa nahodne matica pravdepodobnosti W (napr z roznomernej distribucie cez vsetky matice)
  • v kazdej sekvencii i sa zvoli okno o_{i} dlzky L (rovnomerne z m-L+1 moznosti)
  • V okne sa generuje sekvencia podla profilu W
  • mimo okna sa generuje sekvencia z nulovej hypotezy (nezavisle bazy)

\prod _{{i=1}}^{n}\prod _{{j=1}}^{{L}}w_{{S_{{i,j+o_{i}-1}},j}}\prod _{{j=1}}^{{o_{i}-1}}q_{{S_{{i,j}}}}\prod _{{j=o_{i}+L}}^{m}q_{{S_{{i,j}}}}

Gibbsovo vzorkovanie:

  • Mame dane S, vzorkujeme O (O^{{(0)}},O^{{(1)}},\dots ) (ak treba, z O^{{(t)}} mozeme zostavit maticu W^{{(t)}})
    • zacni s nahodnymi oknami O^{{(0)}}
    • v kroku t+1 zvol jednu sekvenciu i a pre vsetky pozicie o'_{i} spocitaj \Pr(o'_{i}|o_{{-i}}^{{(t)}},S) (kde o_{{-i}}=o_{1}\dots o_{{i-1}}o_{{i+1}}\dots o_{n}, t.j. všetky pozície výskytov okrem i-tej).
    • nahodne zvol jedno o'_{i} umerne k tymto pravdepodobnostiam
    • O^{{(t+1)}} dostaneme z O^{{(t)}} vymenou pozicie v sekvencii i za prave zvolenu
    • opakuj vela krat
  • Konverguje k cielovemu rozdeleniu \Pr(O|S), ale vzorky nie su nezavisle
  • Dalsie mozne kroky vo vzorkovani: posun vsetky okna o konstantu vlavo alebo vpravo
  • Dalsie moznosti rozsirenia modelu/algoritmu: pridaj rozdelenie cez L a nahodne zvacsuj/zmensuj L, dovol vynechat motiv v niektorych sekvenciach, hladaj viac motivov naraz,...

Ako spocitat \Pr(o_{i}|o_{{-i}},S)? (nezaujimaju nas normalizacne konstanty, lahko znormalizujeme scitanim cez vsetky o'_{i})

  • \Pr(o_{i}|o_{{-i}},S)=\Pr(O|S)/\Pr(o_{{-i}}|S), ale menovatel konstanta
  • \Pr(O|S)=\Pr(S|O)\Pr(O)/\Pr(S), kde \Pr(S)=\sum _{{O'}}\Pr(S|O')\Pr(O')
  • Menovatel nas nezaujima (normalizacna konstanta)
  • \Pr(O) je tiez konstanta (rovnomerne rozdelenie pozicii okien)
  • Teda mame \Pr(o_{i}|o_{{-i}},S) je umerne \Pr(S|O)
  • Lahko vieme spocitat \Pr(S|W,O), potrebujeme "zrusit" W, da sa spocitat vzorec...
  • Skusame vsetky mozne hodnoty o'_{i}, pocitame pravdepodobnost \Pr(S|O), vzorkujeme umerne k tomu

Dalsie detaily vypoctu \Pr(S|O):

  • Nech S_{o} su len sekvencie v oknach a S_{{-o}} mimo okien. Mame \Pr(S|O)=\Pr(S_{o}|O)\Pr(S_{{-o}}|O)
  • \Pr(S_{{-o}}|O) lahko spocitame (nezavisi od W)
  • \Pr(S_{o}|O)=\int \Pr(S_{o}|O,W)\Pr(W)dW kde integral ide cez hodnoty, kde w_{{a,i}}\geq 0 a \sum _{a}w_{{a,i}}=1\,
  • \Pr(W) je konstanta (rovnomerne rozdelenie; nejde o pravdepodobnost ale hustotu), \Pr(S_{o}|O,W)=\prod _{{i=1}}^{L}\prod _{a}(w_{{a,i}})^{{n_{{a,i}}}}, kde n_{{a,i}} je pocet vyskytov bazy a na pozicii i v oknach o_{1}\dots o_{n}
  • \Pr(S_{o}|O)=\prod _{{i=1}}^{L}3!/(n+3)!\prod _{a}n_{{a,i}}! (bez dokazu)

Siddharthan R, Siggia ED, van Nimwegen E (December 2005). "PhyloGibbs: a Gibbs sampling motif finder that incorporates phylogeny". PLoS Comput. Biol. 1 (7): e67. doi:10.1371/journal.pcbi.0010067. PMID 16477324.

Gibbs sampling, Gibbsovo vzorkovanie vseobecne

  • Cielove rozdelenie ma n premennych \pi (x_{1},...x_{n})
  • V kazdom kroku vzorkujeme jednu premennu z podmienenej pravdepodobnosti \Pr(x_{i}|x_{1},\dots ,x_{{i-1}},x_{{i+1}},\dots x_{n})
  • Ostatne hodnoty nechame rovnake ako v predchadzajucom kroku
  • Premennu x_{i} zvolime nahodne alebo periodicky i=1,2,\dots ,n
  • Vzorky nie su nezavisle, no vieme dokazat nieco o konvergencii k \pi (pozri nizsie)

Markovove reťazce

  • Markovov reťazec je postupnosť náhodných premenných X_{0},X_{1},\dots , taká, že \Pr(X_{t}|X_{0},\dots ,X_{{t-1}})=\Pr(X_{t}|X_{{t-1}}), t..j. hodnota v čase t závisí len od hodnoty v čase t-1 a nie ďalších predchádzajúcich hodnôt.
  • Nás budú zaujímať homogénne Markovove reťazce, v ktorých \Pr(X_{t}|X_{{t-1}}) nezávisí od t.
  • Tiez nas zaujimaju len retazce v ktorych je X_{t} z konecnej abecedy (mozne hodnoty X_{t} nazyvame stavy)
  • Napriklad stavy A,C,G,T
  • V nasom Gibbsovom vzorkovani bude stav konfiguracia premennych O (.t.j mame (m-L+1)^n stavov)
    • Vzorka v kroku t zavisi od vzorky v kroku t-1 (a lisi sa len v hodnote jedneho o_i)
  • Pravdepodobnosti prechodu medzi stavmi za jeden krok mozeme vyjadrit maticou pravdepodobnosti P, ktorej prvok p_{{i,j}} oznacuje pravdepodobnost prechodu zo stavu i do stavu j p_{{i,j}}=\Pr(X_{t}=j|X_{{t-1}}=i)
  • Sucet kazdeho riadku je 1, cisla nezaporne
  • Ako p_{{ij}}^{{(t)}} budeme oznacovat \Pr(X_{t}=i|X_{{0}}=j), tieto hodnoty dostaneme umocnenim matice P na t
  • Vravime ze matica je ergodicka (niekedy volane regularna), ak P^{t} pre nejake t>0 ma vsetky polozky nenulove
  • Priklady neergodickych matic
1 0          0.5 0.5          0 1             0.5 0.5
0 1          0   1            1 0             1   0
nesuvisla    slabo suvisla    periodicka      ergodicka
  • Rozdelenie \pi na mnozine stavov sa nazyva stacionarne pre Markovov retazec P, ak pre kazde j plati \sum _{{i}}\pi (i)p_{{i,j}}=\pi (j)\, (alebo v maticovej notacii \pi P=\pi )
  • Pre ergodicke matice existuje prave jedno stacionarne rozdelenie, pre ktore navyse plati, ze pre kazde i a j plati \lim _{{t\to \infty }}p_{{i,j}}^{{(t)}}=\pi (j)\,
  • V HMM stavy tvoria Markovov retazec; hladanie genov ergodicky stavovy priestor, profilove HMM nie
  • Ine varianty: nekonecne stavove priestory (zlozitejsia teoria), spojity cas (videli sme pri evolucnych modeloch), retazce vyssieho radu, kde urcujeme \Pr(X_{t}|X_{{t-r}},\dots ,X_{{t-1}}) a pod.
  • Pouzitie v bioinformatike: charakterizacia nahodnych sekvencii (nulova hypoteza), pre DNA sa pouzivaju rady az do 5, lepsie ako nezavisle premenne

Markov chain Monte Carlo MCMC

  • Chceme generovať náhodné vzorky z nejakeho cieloveho rozdelenia \pi , ale toto rozdelenie prilis zlozite.
  • Zostavime ergodicky Markovov retazec, ktoreho stacionarne rozdelenie je rozdelenie \pi , tak aby sme efektivne vedeli vzorkovat X_{{t}} ak vieme X_{{t-1}}.
  • Ak zacneme z lubovolneho bodu, po urcitom case t rozdelenie X_{{t}} priblizne \pi
  • Ale za sebou iduce vzorky nie su nezavisle!
  • Vieme vsak odhadovat ocakavane hodnoty roznych velicin {\frac  {1}{t}}\sum _{{i=1}}^{t}f(X_{t}) konverguje k E_{\pi }[f(X)]

Dokaz spravnosti Gibbsovo vzorkovania

  • Pozor! Gibbsovo vzorkovanie nie je vzdy ergodicke, ak niektore kombinacie hodnot maju nulovu pravdepodobnost!
  • Treba dokazat, ze ak je ergodicky, tak ma ako stacionarnu distribuciu nase zvolene \pi
    • Dokazeme tzv. detailed balance, ze pre kazde dva vektory hodnot x a x' mame \pi (x)p_{{x,x'}}=\pi (x')p_{{x',x}}
    • ak pre nejaky retazec a nejaku distribuciu \pi plati detailed balance, \pi je stacionarna distribucia: \sum _{i}\pi (i)p_{{i,j}}=\sum _{i}\pi (j)p_{{j,i}}=\pi (j)\sum _{i}p_{{j,i}}=\pi (j)\,
    • Pre nas retazec plati detailed balance: uvazujme dva za sebou iduce vektory hodnot x a x', ktore sa lisia v i-tej suradnici. Nech x_{{-i}} su hodnoty vsetkych ostatnych premennych okrem x_{i}
    • \pi (x)p_{{x,x'}}=\pi (x)\Pr(x'_{i}|x_{{-i}})=\Pr(x_{{-i}})\Pr(x_{i}|x_{{-i}})\Pr(x'_{i}|x_{{-i}})=\pi (x')\Pr(x_{i}|x_{{-i}})=\pi (x')\Pr(x_{i}|x'_{{-i}})=\pi (x')p_{{x',x}}

Expresia génov, cvičenia pre biológov

Na týchto cvičeniach sa budeme venovat dvom statistickym temam suvisiacim s komparativnou genomikou a s analyzou expresie genov. Tieto techniky sa vsak vyuzivaju aj v inych oblastiach a mozete sa s nimi casto stretnut v genomickych clankoch.

Nadreprezentacia, obohatenie (enrichment)

  • Mnohe celogenomove analyzy nam daju zoznam genov, ktore sa v nejakom ukazovateli vyrazne lisia od priemeru.
  • Napriklad geny s pozitivnym vyberom v komparativnej genomike, geny vyrazne nadexprimovane alebo podexprimovane v microrarray experimentoch, geny regulovane urcitym transkripcnym faktorom a pod.
  • Niektore z nich budu preskumanejsie (znama funkcia a pod.), niektore mozu mat nejake udaje o funkcii prenesene z homologov a dalsie mozu byt uplne nezname
  • Co s takym zoznamom "zaujimavych genov"?
  • moznost 1: vybrat si z neho niekolko malo zaujimavych kandidatov a preskumat ich podrobnejsie (experimentalne alebo informaticky)
  • moznost 2: zistit, ci tato cela skupina je obohatena o geny urcitych skupin
    • napr. v pripade pozitivneho vyberu nam casto vychadzaju geny suvisiace s imunitou, lebo su pod velkym evolucnym tlakom od patogenov
    • takato analyza nam teda da informaciu o suvislostiach medzi roznymi procesmi
  • Priklad (Kosiol et al)
    • 16529 genov celkovo, 70 genov v GO kategorii innate immune response (0.4% zo vsetkych genov)
    • 400 genov s pozivnym vyberom, mame 8 genov s innate immune response (2% zo vsetky genov s poz. vyb.)
  • Celkovy pocet genov n, imunitnych ni, pozitivny vyber np, imunitnych s poz. vyb. nip.
  • Kontingencna tabulka
Pozitivny vyber Bez poz. vyberu Sucet
Imunitne 8 (nip) 62 70 (ni)
Ostatne 392 16067 16459
Sucet 400 (np) 16129 16529 (n)
  • Nulova hypoteza: geny v nasom zozname boli nahodne vybrane z celeho genomu, t.j. ak v celom genome je frekvencia imunitnych genov ni/n (cca 0.4%), vo vzorke velkosti np (geny s pozitivnym vyberom) ocakavame cca np * (ni / n) imunitnych genov.
    • aj v nulovej hypoteze vsak vzorka velkosti ni cisto nahodou moze obsahovat viac alebo menej takych genov.
    • presnejsie mame urnu so ni (70) bielymi a n-ni (16459) ciernymi gulickami, vytiahneme nahodne np (400) guliciek, kolko bude medzi nimi bielych, nazvime tuto nahodnu premennu Xip
    • v nasom priklade by sme ocakavali 1.7 genu s innate immune response, ale mame 8 (4.7xviac)
  • Rozdelenie pravdepodobnosti Xip je hypergeometricke, t.j. \Pr(X_{{ip}}=n_{{ip}})={n_{i} \choose n_{{ip}}}{n-n_{i} \choose n_{p}-n_{{ip}}}/{n \choose n_{p}}
  • Aka je pravdepodobnost, ze v nulovej hypoteze bude Xip tolko, kolko sme namerali alebo viac? (Chvost rozdelenia). V nasom pripade p-value 2.8e-4.
  • Hypergeometric or Fisher's exact test, pripadne ich aproximacie pre velke hodnoty v tabulke (chi^2 test) zisti, ci sa nasa tabulka velmi lisi od toho, co by sme ocakavali v nulovej hypoteze
  • Suvisiace clanky
    • Rivals I, Personnaz L, Taing L, Potier MC (February 2007). "Enrichment or depletion of a GO category within a class of genes: which test?". Bioinformatics (Oxford, England) 23 (4): 401–7. doi:10.1093/bioinformatics/btl633. PMID 17182697.
    • Huang da W, Sherman BT, Lempicki RA (January 2009). "Bioinformatics enrichment tools: paths toward the comprehensive functional analysis of large gene lists". Nucleic Acids Research 37 (1): 1–13. doi:10.1093/nar/gkn923. PMID 19033363.
  • Kod v statistickom systeme R na pocitanie hypergeometrickeho rozdelenia
> dhyper(0:70, 70, 16529-70, 400);
 [1]  1.793421e-01  3.126761e-01  2.679872e-01  1.505169e-01  6.231088e-02
 [6]  2.027586e-02  5.400796e-03  1.210955e-03  2.332580e-04  3.920215e-05
[11]  5.818723e-06  7.702558e-07  9.166688e-08  9.873221e-09  9.678760e-10
[16]  8.677204e-11  7.143849e-12  5.420388e-13  3.802134e-14  2.472342e-15
[21]  1.493876e-16  8.405488e-18  4.412274e-19  2.164351e-20  9.935473e-22
[26]  4.273662e-23  1.724446e-24  6.533742e-26  2.326517e-27  7.791092e-29
[31]  2.455307e-30  7.285339e-32  2.036140e-33  5.361856e-35  1.330660e-36
[36]  3.112566e-38  6.862558e-40  1.426089e-41  2.792792e-43  5.153006e-45
[41]  8.955105e-47  1.465159e-48  2.255667e-50  3.265636e-52  4.442631e-54
[46]  5.674366e-56  6.797781e-58  7.629501e-60  8.012033e-62  7.860866e-64
[51]  7.193798e-66  6.129013e-68  4.851139e-70  3.558526e-72  2.412561e-74
[56]  1.506983e-76  8.641725e-79  4.530590e-81  2.161126e-83  9.326620e-86
[61]  3.617279e-88  1.250737e-90  3.817900e-93  1.016417e-95  2.323667e-98
[66] 4.469699e-101 7.034762e-104 8.698702e-107 7.924236e-110 4.728201e-113
[71] 1.386176e-116
phyper(7, 70, 16529-70, 400, lower.tail=FALSE);
# pr pocet bielych>7 (t.j. >=8) ak taham 400 z vreca so 70 bielymi a 16529-70 ciernymi
# sucet cisiel z tabulky od 2.332580e-04 az po koniec

d = dhyper(0:15, 70, 16529-70, 400);
plot(0:15,d)

Multiple testing correction

  • V mnohych situaciach robime vela testov toho isteho typu, kazdy ma urcitu p-value
  • Napr. testujeme 1000 genov v genome na pozitivny vyber, zvolime tie, kde p-value <= 0.05
  • Alebo testujeme obohatenie 1000 funkcnych kategorii v nejakej vzorke genov, zvolime tie, kde p-value <= 0.05
  • Problem: ak kazda z 1000 kategorii ma 5% sancu tam byt len nahodou, ocakavali by sme 50 cisto nahodnych pozitivnych vysledkov. Ak sme napr. nasli 100 pozitivnych vysledkov (obohatenych kategorii), cca polovica z nich je zle
  • Preto potrebujeme pri velkom mnozstve testov umelo znizit prah na p-value tak, aby nahodny sum netvoril velke percento nasich vysledkov
  • Toto sa vola multiple testing correction, je viac technik, napr. FDR (false discovery rate)

Zhlukovanie

Príklad dvoch zhlukov
  • Máme vstupné dáta, väčšinou ako vektory dľžky n
  • Snažíme sa ich rozdeliť do skupín tak, aby dáta v rámci skupiny boli podobné a medzi skupinami rôzne

Využitie:

  • hľadanie génov s podobným profilom expresie
  • hľadanie skupín pacientov s podobným profilom expresie génov (objavovanie podtypov nejakej choroby)
  • hľadanie rodín podobných proteínov
  • automatická segmentácia obrázkov (napríklad rozlíšiť jednotlivé políčka microarray alebo gelu od pozadia)

K-Means

Znázornenie vzdialenosti bodov od príslušných centroidov
Vstup: n-rozmerné vektory x_{1},x_{2},...,x_{t} a počet zhlukov k
Výstup: Rozdelenie vektorov do k zhlukov takéto:
c_{1},c_{2},...,c_{t}\;(1\leq c_{i}\leq k) - priradenie vektoru k zhluku
n-rozmerné vektory \mu _{1},\mu _{2},...,\mu _{k} - centrá každého zhluku
Úloha: minimalizovať súčet štvorcov vzdialeností od každého vektoru k centru jeho zhluku:

J(\mu ,c)=\sum _{{i=1}}^{t}{\big \|}x_{i}-\mu _{{c_{i}}}{\big \|}_{2}^{2}

{\big \|}x_{i}-\mu _{{c_{i}}}{\big \|}_{2}^{2} je druhá mocnina vzdialenosti vektora xi od centra jeho zhluku

Algoritmus

Pozri aj clanok na Wikipedii

  1. inicializácia: náhodne vyber k centier \ \mu _{1},\mu _{2},...,\mu _{k}
  2. opakuj až do konvergencie:
    priraď každý bod najbližšiemu centru: c_{i}=\arg \min _{j}{\big \|}x_{i}-\mu _{j}{\big \|}_{2}
    vypočítaj nové centroidy: \mu _{j}=\operatorname {avg_{{i:c_{i}=j}}}x_{i} (spriemerujeme všetky body v jednom zhluku)

Prakticke cvicenie

Data o expresii ludskych genov v roznych tkanivach a podobne v UCSC genome browseri

  • Chodte na stranku http://genome.ucsc.edu/, najdite PTPRZ1 gen v ludskom genome
  • Zvolte Tools->Gene Sorter, sort by nechajme Expression (GNF Atlas 2), search PTPRZ1
    • Dostane tabulku genov s podobny profilom expresie ako PTPRZ1 (červená je vysoká expresia, zelená nízka)
  • Chceme zistiť, či v tomto zozname je nadreprezentovaná nejaká funkčná kategória
    • Potrebujeme najskôr získať zoznam genov bez dalsich udajov
    • Stlacte configure, tlacidlom hide all zrusite vsetky zaskrtnute typy informacie a zakrtnite iba Gene name, stlačíte submit
    • Potom stlačte tlačidlo text a dostanete čisto zoznam mien génov v textovom formáte
    • V prípade problémov ho nájdete ho aj tu
  • http://biit.cs.ut.ee/gprofiler/ mena genov skopirujme do policka Query, stlacte g:Profile!
    • Vo vyslednej tabulke je kazdy riadok jedna funkcna kategoria, v ktorej su geny s tymto profilom expresie nadreprezentovane, kazdy stlpec jeden gen. Mena kategorii su uplne vpravo.
  • Co by sme na zaklade nadreprezentovanych kategorii usudzovali o tomto gene?
  • Najdite tento gen v Uniprote (http://www.uniprot.org/), potvrdzuje nase domnienky?
  • Vratme sa do genome browsera, najdime si PTPRZ1 gen v genome
  • V browseri su rozne tracky tykajuce sa expresie, napr. GNF Atlas 2. Precitajte si, co je v tomto tracku zobrazene, zapnite si ho a pozrite si expresiu okolitych genov okolo PTPRZ1
  • Kliknite na gen v tracku UCSC known genes. V tabulke uvidite zase prehlad expresie v roznych tkanivach (podla GNF Atlasu), linku na Visigene.

NCBI Gene Expression Omnibus http://www.ncbi.nlm.nih.gov/geo/

  • Databaza gene expression dat na NCBI
  • Do okienka Data sets zadajme GDS2925
  • Mali by sme dostat Various weak organic acids effect on anaerobic yeast chemostat cultures
  • Mozeme si pozriet zakladne udaje, napr. citation, platform
  • Link "Expression profiles" nam zobrazi grafy pre rozne geny
  • Pri kazdom profile mozeme kliknut na profile neighbors, aby sme videli geny s podobnym profilom
  • Data analysis tools, cast Cluster heatmaps, K-means, skuste rozne pocty clustrov

Proteíny a gramatiky, cvičenia pre informatikov

Protein threading

Prakticke programy na NP tazke problemy

  • Obcas chceme najst optimalne riesenie nejakeho NP-tazkeho problemu
  • Jedna moznost je previest na iny NP tazky problem, pre ktory existuju pomerne dobre prakticke programy, napriklad integer linear programming (ILP)
  • najdu optimalne riesenie, mnohe instancie zrataju v rozumnom case, ale mozu bezat aj velmi dlho
  • CPLEX [12] a Gurobi [13] komercne baliky na ILP, akademicka licencia zadarmo
  • SYMPHONY v projekte COIN-OR [14] open source
  • Minisat [15] open source SAT solver
  • Concorde TSP solver [16] - riesi problem obchodneho cestujuceho so symetrickymi vzdialenostami, zadarmo na akademicke ucely
    • Pre zaujimavost: TSP art [17]

ILP

Linearny program:

  • Mame realne premenne x_1...x_n, minimalizujeme nejaku ich linearnu kombinaciu \sum _{i}a_{i}x_{i}\, kde a_i su dane vahy.
  • Mame tiez niekolko podmienok v tvare linearnych rovnosti alebo nerovnosti, napr. \sum _{i}b_{i}x_{i}\leq c
  • Hladame teda hodnoty premennych, ktore minimalizuju cielovu sumu, ale pre ktore platia vsetky podmienky
  • Da sa riesit v polynomialnom case

Integer linear program

  • Program, v ktorom vsetky premenne musia mat celociselne hodnoty, alebo dokonca povolime oba hodnoty 0 a 1.
  • NP uplny problem

Ako zapisat (NP-tazke) problemy ako ILP

Knapsack

  • Problem: mame dane predmety s hmotnostami w_1..w_n a cenami c_1..c_n, ktore z nich vybrat, aby celkova hmotnost bola najviac T a cena bola co najvyssia?
  • Pouzijeme binarne premenne x_1..x_n, kde x_i = 1 prave vtedy ked sme zobrali i-ty predmet.
  • Chceme maximalizovat \sum _{i}c_{i}x_{i}\,
  • za podmienky ze \sum _{i}w_{i}x_{i}\leq T

Set cover:

  • Mame n mnozin S_1...S_n nad mnozinou {1...m}. Chceme vybrat co najmensiu pomnozinu A tak, aby kazde S_i obsahovalo aspon jeden prvok z A
  • Binarne premenne x_i=1 ak vyberieme i-ty prvok
  • Chceme minimalizovat \sum _{i}x_{i}\,
  • za podmienky, ze pre kazde i plati \sum _{{j\in S_{i}}}x_{j}\geq 1

Protein threading

  • Ciel: protein A ma znamu sekvenciu aj strukturu, protein B iba sekvenciu. Chceme zarovnat proteiny A a B, pricom budeme brat do uvahy znamu strukturu, t.j. ak su dve amino kyseliny blizko v A tak ich ekvivalenty v B by mali byt "kompatibilne".
  • Tento problem chceme riesit tak, ze v strukture A urcime nejake jadra, ktore by v evolucii mali zostat zachovane bez inzercii a delecii a v rovnakom poradi. Tieto jadra su oddelene sluckami, ktorych dlzka sa moze lubovolne menit a ktorych zarovnania nebudeme skorovat.
  • Formulacia problemu: Mame danu sekvenciu B=b1..bn, dlzky m jadier c_1...c_m a skorovacie tabulky E_ij, ktora vyjadruje, ako dobre bj..b_{j+c_i-1} sedi do sekvencie jadra i a E_ijkl ktora vyjadruje, ako dobre by jadra i a k interagovali, keby mali sekvencie zacinajuce v B na poziciach j a l. Uloha je zvolit polohy jadier x_1<x_2<...<x_m tak, aby sa ziadne dve jadra neprekryvali a aby sme dosiahli najvyssie skore.
  • Poznamka: nevraveli sme, ako konkretne zvolit jadra a skorovacie tabulky, co je modelovaci, nie algoritmicky problem (mozeme skusit napr. nejake pravdepodonostne modely)

Protein threading ako ILP

  • Premenne v programe:
    • x_ij=1 ak je zaciatok i-teho jadra zarovnane s b_j
    • y_ijkl=1 ak je zaciatok i-teho jadra na b_j a zaciatok k-teho na b_l (i<k, j<l)
  • Chceme maximalizovat \sum E_{{ij}}x_{{ij}}+\sum E_{{ijkl}}y_{{ijkl}}
  • Podmienky:
    • \sum _{j}x_{{ij}}=1\, pre kazde i
    • x_{{il}}+x_{{i+1,k}}=\leq 1 pre vsetky i,k,l, kde k<l+c_i
    • y_{{ijkl}}\leq x_{{ij}} pre vsetky i,j,k,l, kde i<k, j<l
    • y_{{ijkl}}\leq x_{{kl}} pre vsetky i,j,k,l, kde i<k, j<l
    • y_{{ijkl}}\geq x_{{ij}}+x_{{kl}} pre vsetky i,j,k,l, kde i<k, j<l

Na zamyslenie:

  • Aka bude velkost programu ako funkcia n a m?
  • Co ak nie vsetky jadra navzajom interaguju? Mozeme na velkosti programu usetrit?
  • Preco asi vobec autori zaviedli jadra a ako by sme zmenili program, ak by sme chceli uvazovat kazdu aminokyselinu zvlast?

Bezkontextové gramatiky

  • Na modelovanie struktury RNA sa pouzivaju stochasticke bezkontextove gramatiky (bude na dalsej prednaske)
  • My si teraz ukazeme bezkontextove gramatiky, ktore nemaju pravdepodobnosti
  • Zaviedol Noam Chomsky v lingvistike 50-te roky 20. storocia, tiez dolezite v informatike
  • Gramatika
    • Dva typy symbolov: terminaly (male pismena), neterminaly (velke pismena)
    • Pravidla prepisujuce neterminal na retazec terminalov a neterminalov (moze byt aj prazdny retazec, ktory oznacujeme epsilon)
    • Neterminal S je "startovaci"
    • Priklad: S->aSb, S->epsilon (piseme aj skratene S->aSb|epsilon)
  • Pouzitie gramatiky na generovanie retazcov
    • Zacneme so startovacim neterminalom S
    • V kazdom kroku prepiseme najlavejsi neterminal podla niektoreho pravidla
    • Skoncime, ked nezostanu ziadne neterminaly
  • Priklad: S->aSb->aaSbb->aaaSbbb->epsilon
    • Ake vsetky slova vie tato gramatika generovat?
    • V tvare aa...abb...b s rovnakym poctom acok a bciek (informatici pisu a^kb^k)
  • Zostavte gramatiku na slova typu aa..abb..b kde acok je rovnako alebo viac ako bcok
    • S->aSb|aS|epsilon
  • zostavte gramatiku pre slova toho isteho typu, kde acok je viac ako bcok
    • S->aSb|aT T->aT|epsilon (alebo S->aSb|aS|a)
  • uvazujme dobre uzatvorkovane vyrazy zo zatvoriek (,),[,] napr. [()()([])] je dobre uzatvorkovany, ale [(]) nie je.
    • S->SS|(S)|[S]|epsilon
    • S->[S]->[SS]->[SSS]->[(S)SS]->[()SS]->[()(S)S]->[()()S]->[()()(S)]->[()()([S])]->[()()([])]
    • Parsovanie retazca pomocou gramatiky: urcit, ako mohol byt retazec vygenerovany pomocou pravidiel
    • Tato gramatika nam pomoze urcit, ktora zatvorka patri ku ktorej: tie, ktore boli vygenerovane v jednom kroku
  • Zostavte gramatiku na DNA palindromy, t.j. sekvencie, ktore zozadu po skomplementovani baz daju to iste, ako napr. GATC
    • S->gSc|cSg|aSt|tSa|epsilon
  • Zostavte gramatiku na slova s rovnakym poctom acok a bcok v lubovolnom poradi
    • S->epsilon|aSbS|bSaS
    • preco vie vygenerovat vsetky take retazce?

Proteíny a gramatiky, cvičenia pre biológov

Bezkontextové gramatiky

  • Na modelovanie struktury RNA sa pouzivaju stochasticke bezkontextove gramatiky (bude na dalsej prednaske)
  • My si teraz ukazeme bezkontextove gramatiky, ktore nemaju pravdepodobnosti
  • Zaviedol Noam Chomsky v lingvistike 50-te roky 20. storocia, tiez dolezite v informatike
  • Gramatika
    • Dva typy symbolov: terminaly (male pismena), neterminaly (velke pismena)
    • Pravidla prepisujuce neterminal na retazec terminalov a neterminalov (moze byt aj prazdny retazec, ktory oznacujeme epsilon)
    • Neterminal S je "startovaci"
    • Priklad: S->aSb, S->epsilon (piseme aj skratene S->aSb|epsilon)
  • Pouzitie gramatiky na generovanie retazcov
    • Zacneme so startovacim neterminalom S
    • V kazdom kroku prepiseme najlavejsi neterminal podla niektoreho pravidla
    • Skoncime, ked nezostanu ziadne neterminaly
  • Priklad: S->aSb->aaSbb->aaaSbbb->epsilon
    • Ake vsetky slova vie tato gramatika generovat?
    • V tvare aa...abb...b s rovnakym poctom acok a bciek (informatici pisu a^kb^k)
  • Zostavte gramatiku na slova typu aa..abb..b kde acok je rovnako alebo viac ako bcok
    • S->aSb|aS|epsilon
  • zostavte gramatiku pre slova toho isteho typu, kde acok je viac ako bcok
    • S->aSb|aT T->aT|epsilon (alebo S->aSb|aS|a)
  • uvazujme dobre uzatvorkovane vyrazy zo zatvoriek (,),[,] napr. [()()([])] je dobre uzatvorkovany, ale [(]) nie je.
    • S->SS|(S)|[S]|epsilon
    • S->[S]->[SS]->[SSS]->[(S)SS]->[()SS]->[()(S)S]->[()()S]->[()()(S)]->[()()([S])]->[()()([])]
    • Parsovanie retazca pomocou gramatiky: urcit, ako mohol byt retazec vygenerovany pomocou pravidiel
    • Tato gramatika nam pomoze urcit, ktora zatvorka patri ku ktorej: tie, ktore boli vygenerovane v jednom kroku
  • Zostavte gramatiku na DNA palindromy, t.j. sekvencie, ktore zozadu po skomplementovani baz daju to iste, ako napr. GATC
    • S->gSc|cSg|aSt|tSa|epsilon
  • Zostavte gramatiku na slova s rovnakym poctom acok a bcok v lubovolnom poradi
    • S->epsilon|aSbS|bSaS
    • preco vie vygenerovat vsetky take retazce?

Proteíny

  • Toto cvičenie je z časti inšpirované stránkou [18]
  • Pozrieme sa na enzým Bis(5'-adenosyl)-triphosphatase
  • Nájdime ho na stránke http://www.uniprot.org/ pod názvom FHIT_HUMAN
    • O mnohých údajoch na stránke sme sa rozprávali na prednáške (GO kategórie, domény, sekundárna a 3D štruktúra)
    • Všimnime si Pfam doménu a pozrime si jej stránku, do akej super-rodiny (klanu) patrí?


  • Tento enzým je vzdialene podobný na enzým galactose-1-phosphate uridylyltransferase (GALT/GAL7)
  • Skúsme nájsť túto podobnosť v BLASTe: http://blast.ncbi.nlm.nih.gov/ v časti proteíny, zvoľme databázu Swissport, ako Query zadajme Accesion nášho proteínu P49789
  • GAL gén (konkrétne GAL7_HAEIN) sa nachádza medzi výsledkami, ale s vysokou E-value
  • Odložme si tieto výsledky a v novom okne spustíme PSI-BLAST, dve iterácie
  • Aká je E-value teraz? V čom sa líšia zarovnania?


  • Nájdime v Uniprote proteín GAL7_HAEIN.
  • Ak sa pozrieme na jeho Pfam domény, v akom sú klane?

Sekvenčné motívy

MEME

  • Vazobne miesta transkripcnych faktorov sa casto reprezentuju ako sekvencne motivy
  • Ak mame skupinu sekvencii, mozeme hladat motiv, ktory maju spolocny
  • Znamy program na tento problem je MEME
  • Chodte na stranku http://meme.nbcr.net/
  • Zvolte nastroj MEME a do okienka "actual sequences" zadajte tieto sekvencie
  • Pozrite si ostatne nastavenia. Co asi robia?
  • Ak server pocita dlho, mozete si pozriet vysledky tu

Kvasinkové transkripčné faktory v SGD

  • Yeast genome database SGD obsahuje pomerne podrobne stranky pre jednotlive transkripcne faktory
  • Pozrime si stranku pre transkripcny faktor GAL4 [19]

RNA a databázy, cvičenia pre informatikov

RNA struktura

  • Opakovanie Nussinovho algoritmu


Z cvičných príkladov na skúšku

  • Vyplnte maticu dynamického programovania (Nussinovov algoritmus) pre nájdenie najväčšieho počtu dobre uzátvorkovaných spárovaných báz v RNA sekvencii GAACUUCACUGA (dovoľujeme len komplementárne páry A-U, C-G) a nakreslite sekundárnu štruktúru, ktorú algoritmus našiel.
 G A A C U U C A C U G A
 0 0 0 1 1 2 3 3 3 4 4 4  G
   0 0 0 1 2 2 2 2 3 4 4  A
     0 0 1 1 1 2 2 2 3 4  A
       0 0 0 0 1 1 1 2 3  C
         0 0 0 1 1 1 2 3  U
           0 0 1 1 1 2 3  U
             0 0 0 1 2 2  C
               0 0 1 1 1  A
                 0 0 1 1  C
                   0 0 1  U
                     0 0  G
                       0  A

Rozsirte Nussinovov algoritmus na pripad, ze chceme davat skore iba "stackovanym parom", t.j. ak i a j aj i+1 a j-1 su sparovane

Úvod do bioinformatických databáz a on-line nástrojov

NCBI, Genbank, Pubmed, blast

  • National Center for Biotechnology Information http://www.ncbi.nlm.nih.gov/
  • Zhromazduje verejne pristupne data z molekularnej biologie
  • Mozeme hladat klucove slova v roznych databazach
    • Pubmed: databaza clankov, napr. najdime phastcons
    • Books: najdime Alu
    • Gene: najdime DNA polymerazu
    • BLAST: najdime nasledujucu sekvenciu v genome kurata (zvoľme nucleotide blast, database others a z menu reference genomic sequence, organism chicken (taxid:9031), program blastn)
    • Ide o osekvenovany kusok ludskej mRNA, kde v kuracom genome sme nasli homolog, ake ma dlzku, skore, E-value, % zhodnych baz?
AACCATGGGTATATACGACTCACTATAGGGGGATATCAGCTGGGATGGCAAATAATGATTTTATTTTGAC
TGATAGTGACCTGTTCGTTGCAACAAATTGATAAGCAATGCTTTCTTATAATGCCAACTTTGTACAAGAA
AGTTGGGCAGGTGTGTTTTTTGTCCTTCAGGTAGCCGAAGAGCATCTCCAGGCCCCCCTCCACCAGCTCC
GGCAGAGGCTTGGATAAAGGGTTGTGGGAAATGTGGAGCCCTTTGTCCATGGGATTCCAGGCGATCCTCA
CCAGTCTACACAGCAGGTGGAGTTCGCTCGGGAGGGTCTGGATGTCATTGTTGTTGAGGTTCAGCAGCTC
CAGGCTGGTGACCAGGCAAAGCGACCTCGGGAAGGAGTGGATGTTGTTGCCCTCTGCGATGAAGATCTGC
AGGCTGGCCAGGTGCTGGATGCTCTCAGCGATGTTTTCCAGGCGATTCGAGCCCACGTGCAAGAAAATCA
GTTCCTTCAGGGAGAACACACACATGGGGATGTGCGCGAAGAAGTTGTTGCTGAGGTTTAGCTTCCTCAG
TCTAGAGAGGTCGGCGAAGCATGCAGGGAGCTGGGACAGGCAGTTGTGCGACAAGCTCAGGACCTCCAGC
TTTCGGCACAAGCTCAGCTCGGCCGGCACCTCTGTCAGGCAGTTCATGTTGACAAACAGGACCTTGAGGC
ACTGTAGGAGGCTCACTTCTCTGGGCAGGCTCTTCAGGCGGTTCCCGCACAAGTTCAGGACCACGATCCG
GGTCAGTTTCCCCACCTCGGGGAGGGAGAACCCCGGAGCTGGTTGTGAGACAAATTGAGTTTCTGGACCC
CCGAAAAGCCCCCACAAAAAGCCG

Uniprot

  • Prehladnejsi pohlad na proteiny, vela linkov na ine databazy, cast vytvarana rucne
    • Pozrieme sa na enzým Bis(5'-adenosyl)-triphosphatase
    • Nájdime ho na stránke http://www.uniprot.org/ pod názvom FHIT_HUMAN
    • Pozrime si podrobne jeho stránku, ktoré časti boli predpovedané bioinformatickými metódami z prednášky?
    • Všimnime si Pfam doménu a pozrime si jej stránku, do akej super-rodiny (klanu) patrí?

UCSC genome browser

Sekvenovanie

  • Hore v modrom menu zvoľte Genomes
  • Na ďalšej stránke zvoľte človeka a v menu Assembly zistite, kedy boli pridané posledné dve verzie ľudského genómu (hg18 a hg19)
  • Na tej istej stránke dole nájdete stručný popis zvolenej verzie genómu. Pre ktoré chromozómy máme viacero alternatívnych verzií?
  • Zadajte región chr21:31,200,000-31,400,000
  • Zapnite si track Mapability na "pack" a track RepeatMasker prepnite na "full"
  • Mapability: nakoľko sa daný úsek opakuje v genóme a či teda vieme jednoznačne jeho ready namapovať pri použití Next generation sequencing (detaily keď kliknete na linku "Mapability")
  • Približne v strede zobrazeného regiónu je pokles mapovateľnosti. Akému typu opakovania zodpovedá? (pozrite track RepeatMasker)
  • Zapnite si tracky "Assembly" a "Gaps" a pozrite si región chr2:110,000,000-110,300,000. Aká dlhá je neosekvenovaná medzera (gap) v strede tohto regiónu? Približnú veľkosť môžete odčítať z obrázku, presnejší údaj zistíte kliknutím na čierny obdĺžnik zodpovedajúci tejto medzere (úplne presnú dĺžku aj tak nepoznáme, nakoľko nie je osekvenovaná).

Geny

  • Zvolte starsiu verziu ludskeho genomu hg18, ktora ma viac informacii
  • Do okienka position zadajte gen MAGEA2B a potom zvolte jeden jeho vyskyt (ma dva vyskyty)
    • Dostanete sa tam aj touto linkou: [20]
  • Ak date 3x zoom out, mozete si vsimnut, ze tento gen ma viacero foriem zostrihu, ktore sa ale lisia iba v 5' UTR
  • Vela veci sa mozete dozvediet klikanim na rozne casti broswera: napr, kliknutim na gen si mozete precitat o jeho funkcii, kliknutim na listu ku tracku (lavy okraj obazku) sa dozviete viac o tracku a mozete nastavovat parametre zobrazenia

Komparativna genomika

  • V casti multiz alignments vidite zarovnania k roznym inym genomom (da sa zapinat, ze ku ktorym). Mozete si pozriet, ako sa uroven zarovnania zmeni ked sa priblizujeme a vzdalujeme (zoom in/zoom out).
  • Ked sa priblizite spat na gen MAGEA2B a potom tak, aby ste boli na urovni "base", t.j. zobrazenych cca 100bp, v obdlzniku multiz alignment uvidite zarovnanie s homologickym usekom v inych genomoch. Konkretne v MAGEA2B vidime pomerne dost rozdielov v proteine medzi clovekom a makakom rezus, vdaka ktorym bol zrejme klasifikovany ako pod pozitivnym vyberom.
  • V casti conservation by PhyloP vidime graf toho, ako silne su zachovane jednotlive stlpce zarovnania
  • Da sa zapnut track Placental Chain/Net a pozriet sa na ktorych chromozomoch je ortologicky usek v inych genomoch

Blat

  • Choďte na UCSC genome browser (http//genome.ucsc.edu/), na modrej lište zvoľte BLAT, zadajte túto sekvenciu a hľadajte ju v ľudskom genóme. Akú podobnosť (IDENTITY) má najsilnejší nájdený výskyt? Aký dlhý úsek genómu zasahuje? (SPAN). Všimnite si, že ostatné výskyty sú oveľa kratšie.
  • V stĺpci ACTIONS si pomocou Details môžete pozrieť detaily zarovnania a pomocou Browser si pozrieť príslušný úsek genómu.
  • V tomto úseku genómu si zapnite track Vertebrate net na full a kliknutím na farebnú čiaru na obrázku pre tento track zistite, na ktorom chromozóme kuraťa sa vyskytuje homologický úsek.
  • Skusme tu istu sekvenciu namapovat do genomu sliepky: stlacte najprv na hornej modrej liste Genomes, zvolte Vertebrates a Chicken a potom na hornej liste BLAT. Do okienka zadajte tu istu sekvenciu. Akú podobnosť a dĺžku má najsilnejší nájdený výskyt teraz? Na ktorom je chromozóme?
  • Ako sa to porovna s hodnotami, ktore sme dostali pomocou BLASTu na NCBI?

Práca s tabuľkami, sťahovanie anotácií

  • Položka Tables na hornej lište umožnuje robiť rafinované veci s tabuľkami, ktoré obsahujú súradnice génov a pod.
  • Základná vec: vyexportovať napr. všetky gény v zobrazenom výseku v niektorom formáte:
    • sequence: fasta súbor proteínov, génov alebo mRNA s rôznymi nastaveniami
    • GTF: súradnice
    • Hyperlinks to genome browser: klikacia stránka
  • Namiesto exportu si môžeme pozrieť rôzne štatistiky
  • Zložitejšie: prienik dvoch tabuliek, napr. gény, ktoré sú viac než 50% pokryté simple repeats
    • V intersection zvolíme group: Variation and repeats, track: RepeatMasker, nastavíme records that have at least 50% overlap with RepeatMasker
    • V summary/statistics zistíme, kolko ich je v genóme, môžeme si ich preklikať cez Hyperlinks to genome browser
  • Filter na tabuľku, napr. gény, ktoré majú v názve ribosomal (postup pre drozofilu):
    • V casti hg19.kgXref based filters políčko description dáme *ribosomal*

Fylogeneticke stromy, mobyle portal

  • V UCSC browseri mozeme ziskavat viacnasobne zarovnania jednotlivych genov (nukleotidy alebo proteiny). Nasledujuci postup nemusite robit, subor si stiahnite tu: http://compbio.fmph.uniba.sk/vyuka/mbi/poznamky/cb06/cb06-aln.fa
    • UCSC browseri si pozrieme usek ludskeho genomu chr6:136,214,527-136,558,402 s genom PDE7B (phosphodiesterase 7B)
    • Na modrej liste zvolime Tables, v nej RefSeq genes, zaklikneme Region: position, a Output fomat: CDS FASTA alignment a stlacime Get output
    • Na dalsej obrazovke zaklikneme show nucleotides. Z primatov zvolime chimp, rhesus, tarsier, z inych cicavcov mouse, rat, dog, elephant a z dalsich organizmov opposum, platypus, chicken, lizard, stlacime Get output.
    • Vystup ulozime do suboru, z mien sekvencii zmazeme spolocny prefix NM_018945_, pripadne celkovo prepiseme mena na anglicke nazvy
  • Skusme zostavit strom na stranke http://mobyle.pasteur.fr/cgi-bin/portal.py
  • Pouzijeme program quicktree, metodu neighbor joining, bootstrap 100
  • Na zobrazenie stromu vysledok dalej prezenieme cez zobrazovacie programy drawtree alebo newicktops (zvolit v menu pri tlacidle further analysis)
    • Vysledok z drawtree, nezakoreneny, nezobrazuje bootstrap hodnoty
    • Vysledok z newicktops, zakoreneny na nahodnom mieste (nie spravne) zobrazuje bootstrap hodnoty
    • v drawtree sme nastavili sme formát výstupu MS-Windows Bitmap a X,Y resolution aspoň 1000, v newicktops sme nastavili show bootstrap values
  • "Spravny strom" [21] v nastaveniach Conservation track-u v UCSC browseri (podla clanku Murphy WJ, Eizirik E, O'Brien SJ, Madsen O, Scally M, Douady CJ, Teeling E, Ryder OA, Stanhope MJ, de Jong WW, Springer MS. Resolution of the early placental mammal radiation using Bayesian phylogenetics. Science. 2001 Dec 14;294(5550):2348-51.)
  • Nas strom ma long branch attraction (zle postavenie hlodavcov, ktori maju dlhu vetvu aj slona, co moze byt zapricene sekvenovacimi chybami).
  • Ine programy, ktore mozete skusit na mobyle
    • phyml: metoda maximalnej vierohodnosti (daju sa nastavit detaily modelu, bootstraps, ktory ale moze dost dlho trvat, typy operacii na strome pri heuristickom hladani najlepsieho stromu)
    • dnapars alebo protpars na parsimony
    • viacnasobne zarovnanie pomocou clustalw alebo modernejsou alternativou muscle
    • Ak chcete skusat zarovnania, zacnite z nezarovnanych sekvencii: http://compbio.fmph.uniba.sk/vyuka/mbi/poznamky/cb06/cb06-seq.fa

RNA, cvičenia pre biológov

Nussinovov algoritmus

Z cvičných príkladov na skúšku

  • Vyplnte maticu dynamického programovania (Nussinovov algoritmus) pre nájdenie najväčšieho počtu dobre uzátvorkovaných spárovaných báz v RNA sekvencii GAACUUCACUGA (dovoľujeme len komplementárne páry A-U, C-G) a nakreslite sekundárnu štruktúru, ktorú algoritmus našiel.
 G A A C U U C A C U G A
 0 0 0 1 1 2 3 3 3 4 4 4  G
   0 0 0 1 2 2 2 2 3 4 4  A
     0 0 1 1 1 2 2 2 3 4  A
       0 0 0 0 1 1 1 2 3  C
         0 0 0 1 1 1 2 3  U
           0 0 1 1 1 2 3  U
             0 0 0 1 2 2  C
               0 0 1 1 1  A
                 0 0 1 1  C
                   0 0 1  U
                     0 0  G
                       0  A

Prakticke cvicenie

  • Znama databaza rodin RNA genov je Rfam
  • Najdite si v nej rodinu RF00015 (U4 spliceosomal RNA)
  • V casti Secondary structure si mozete pozriet obrazky farebne kodovane podla roznych kriterii
    • Skuste pochopit, co jednotlive obrazky a ich farby znamenaju
  • Jedna z mnohych ludskych kopii je tato:
AGCTTTGCGCAGTGGCAGTATCGTAGCCAATGAGGTTTATCCGAGGCGCG
ATTATTGCTAATTGAAAACTTTTCCCAATACCCCGCCATGACGACTTGAA
ATATAGTCGGCATTGGCAATTTTTGACAGTCTCTACGGAGA
  • Skuste ju najst v ludskom genome nastrojom BLAT v UCSC genome browseri
  • Pozrite si tracky Mapability, Ensembl genes, conservation, Repeats v jej okoli
  • Pozrite si track "CSHL Sm RNA-seq" ktory obsahuje RNASeq kratkych RNA z roznych casti buniek, zapnite si v jeho nastaveniach aj zobrazenie RNA z jadra (nucleus)
  • Zadajte sekvenciu na RNAfold serveri [22]
  • Ak vypocet dlho trva, pozrite si vysledok tu
  • Podoba sa na strukturu zobrazenu v Rfame? v com sa lisi?

Zhrnutie semestra a proteomika, cvičenia pre informatikov

Zhrnutie semestra

  • vid prezentacia k cviceniu

Uvod do proteomiky

Gélová elektroforéza (gel electrophoresis)

  • Izolovanie jednotlivých proteínov, porovnávanie ich množstva.
  • Negatívne nabité proteíny migrujú v géli v elektrickom poli. Väčšie proteíny migrujú pomalšie, dochádza v oddeleniu do pruhov. Táto metóda sa používa aj na DNA a RNA. Pre proteíny možno tiež robiť 2D gél (podľa hmotnosti a náboja).
  • Bioinformatický problém: zisti, ktoré fliačiky na dvoch 2D géloch zodpovedajú tým istým proteínom.
  • Automatizovanejšia technológia: kvapalinová chromatografia (liquid chromatography) - separácia proteínov v tenkom stĺpci

Hmotnostná spektrometria (mass spectrometry)

  • Hmotnostná spektrometria meria pomer hmostnosť/náboj molekúl vo vzorke.
  • Používa sa na identifikáciu proteínov, napr. z 2D gélu.
  • Proteín nasekáme enzýmom trypsín (seká na [KR]{P}) na peptidy
  • Meriame hmostnosť kúskov, porovnáme s databázou proteínov.
  • Tandemová hmotnostná spektrometria (MS/MS) ďalej fragmentuje každý kúsok a dosiahne podrobnejšie spektrum, ktoré obsahuje viac informácie

Sekvenovanie proteinov pomocou MS/MS

Berme do uvahy len b-iony, ktore zodpovedaju hmotnosti prefixu

  • Vsetky hmotnosti budu cele cisla, pozname celkovu hmotnost peptidu M a hmotnosti aminokyselin a_{1}\dots a_{{20}}
  • Mame skorovaciu funkciu/tabulku f(m), ktora pre prefix peptidu s hmotnostou m urci skore, ako dobre sedi so spektrom
  • Chceme najst peptid, ktory maximalizuje sucet skore svojich prefixov
  • Dynamicke programovanie s podproblemom A[m] je skore najlepsieho prefixu s hmotnostou m
    • Rekurencia? Zlozitost? Je to polynomialny algoritmus? (Co je vlastne vstup?)

Co ak berieme do uvahy aj y-iony, ktore meraju hmotnost sufixu?

  • Idea 1: pouzijeme upravenu skorovaciu funkciu f'(m): skontroluje signal na pozicii m aj M-m
  • Problem: jeden signal sa moze ratat dvakrat, raz ako b-ion, raz ako y-ion, algoritmus ma tendenciu pridavat taketo artefakty
  • Nove skorovanie: ak hmotnost nejakeho prefixu a nejakeho sufixu su rovnake, zarataj ich skore iba raz (skore peptidu je skore mnoziny hmotnosti jeho prefixov a sufixov)
  • Vid info na slajdoch
  • Definuj novy podproblem: A[p,s] je najlepsie skore, ktore moze dosiahnut prefix s hmotnostou p a sufix s hmotnostou s
  • Budeme uvazovat p,s<=M/2, pricom f(m) stale skontroluje signal na pozicii m aj M-m

A[p,s]=\left\{{\begin{array}{ll}\max _{{i=1\dots 20}}A[p,s-a_{i}]+f(s)&{\mbox{ak }}p<s\\\max _{{i=1\dots 20}}A[p-a_{i},s]+f(p)&{\mbox{ak }}p>s\\\max _{{i=1\dots 20}}A[p-a_{i},s]&{\mbox{ak }}p=s\\\end{array}}\right.

  • Ako ukoncime dynamicke programovanie? Zlozitost?
  • Zrychlenie: staci uvazovat s od p-w po p+w kde w je maximalna hmotnost aminokyseliny

Detekcia znamych proteinov pomocou MS

  • Predikcia spektra pre dany peptid, porovnanie s realnym spektrom, zlozite skorovacie schemy
  • Filtrovanie kandidatov na proteiny, ktore obsahuju peptidy s pozorovanou hmotnostou
  • Problem: mame danu databazu proteinov a cielovu hmotnost peptidu M, pozname hmotnost kazdej aminokyseliny. Najdite vsetky podretazce s hmotnostou M.
  • Databazu proteinov si vieme predstavit aj ako postupnost cisel - hmotnosti aminokyselin, hladame intervaly so suctom M.
  • Trivialny algoritmus: zacni na kazdej pozicii, pricitavaj kym nedosiahnes hmotnost>=M. Zlozitost? Vieme zlepsit?
  • Predspracovanie: pocitajme hmotnosti vsetkych podretazcov, potom vyhladajme binarne. Zlozitost?

Zhrnutie semestra a populačná genomika, cvičenia pre biológov

Zhrnutie semestra

  • vid prezentacia k cviceniu

Populacna genomika v UCSC genome browseri

UCSC genome browser ma viacero trackov tykajucich sa populacnej genomiky a polymorfizmov

  • Pozrite si napriklad region chr2:174,862-436,468 v hg19
  • V casti Phenotype and Disease Associations si zapnite GAD view
  • V casti Variation and Repeats si zapnite
    • HGDP Allele Freq na Pack (po kliknuti na SNP zobrazi mapu sveta s distribuciou alel)
    • "DGV Struct Var" na Pack
  • Track Genome Variants obsahuje genomy niekolkych ludi, napr Jim Watsona
  • Takisto sa da pozriet genom ludi z jaskyne Denisova a Neandertalcov

V starsej verzii ludskeho genomu je aj trojuholnikovy graf linkage disequilibria

  • region vyssie premapovany do hg18
  • zapnite "HapMap LD Phased" na Full (cast Variation and Repeats)
  • vsimnite si, ze miery LD sa medzi ludskymi podpopulaciami lisia (YRI: Nigeria; CEU: Europa; JPT+CHB: Japonsko, Cina)

Browser diverzity u S.cerevisae:

Články na journal club

Zadelenie študentov do skupín:

4. Siepel A, Bejerano G, Pedersen JS, Hinrichs AS, Hou M, Rosenbloom K et al. (2005). "Evolutionarily conserved elements in vertebrate, insect, worm, and yeast genomes". Genome Res 15 (8): 1034-50. doi:10.1101/gr.3715005. PMID 16024819. Čítajú Cetlová, Kalmancai, Kemény, Krajči, Mojzeš, Moravčík

5. Wapinski I, Pfeffer A, Friedman N, Regev A (2007). "Natural history and evolutionary principles of gene duplication in fungi". Nature 449 (7158): 54-61. doi:10.1038/nature06107. PMID 17805289. Čítajú Frankovský, Hitka, Lukča, Párnický, Tóth, Turčáni

6. Clamp M, Fry B, Kamal M, Xie X, Cuff J, Lin MF et al. (2007). "Distinguishing protein-coding and noncoding genes in the human genome.". Proc Natl Acad Sci U S A 104 (49): 19428-33. doi:10.1073/pnas.0709013104. PMID 18040051. Čítajú Bačo, Gerčak, Hozza, Kruľ, Michlíková, Skalický

12. Hernandez RD, Hubisz MJ, Wheeler DA, Smith DG, Ferguson B, Rogers J et al. (2007). "Demographic histories and patterns of linkage disequilibrium in Chinese and Indian rhesus macaques.". Science 316 (5822): 240-3. doi:10.1126/science.1140462. PMID 17431170. Čítajú Ballon, Karabínošová, Olleríny, Otrubčiak, Rataj, Vyskočilová


Nevybrané články

1. Zerbino DR, Birney E (2008). "Velvet: algorithms for de novo short read assembly using de Bruijn graphs.". Genome Res 18 (5): 821-0. doi:10.1101/gr.074492.107. PMID 18349386.

2. Lunter G (2007). "Probabilistic whole-genome alignments reveal high indel rates in the human and mouse genomes.". Bioinformatics 23 (13): i289-96. doi:10.1093/bioinformatics/btm185. PMID 17646308.

3. Kent WJ, Baertsch R, Hinrichs A, Miller W, Haussler D (2003). "Evolution's cauldron: duplication, deletion, and rearrangement in the mouse and human genomes.". Proc Natl Acad Sci U S A 100 (20): 11484-9. doi:10.1073/pnas.1932072100. PMID 14500911.

7. Eisen MB, Spellman PT, Brown PO, Botstein D (1998). "Cluster analysis and display of genome-wide expression patterns.". Proc Natl Acad Sci U S A 95 (25): 14863-8. PMID 9843981.

8. Harbison CT, Gordon DB, Lee TI, Rinaldi NJ, Macisaac KD, Danford TW et al. (2004). "Transcriptional regulatory code of a eukaryotic genome.". Nature 431 (7004): 99-104. doi:10.1038/nature02800. PMID 15343339.

9. Bystroff C, Thorsson V, Baker D (August 2000). "HMMSTR: a hidden Markov model for local sequence-structure correlations in proteins". J. Mol. Biol. 301 (1): 173–90. doi:10.1006/jmbi.2000.3837. PMID 10926500.

10. Sharan R, Suthram S, Kelley RM, Kuhn T, McCuine S, Uetz P et al. (2005). "Conserved patterns of protein interaction in multiple species.". Proc Natl Acad Sci U S A 102 (6): 1974-9. doi:10.1073/pnas.0409522102. PMID 15687504.

11. Andronescu M, Fejes AP, Hutter F, Hoos HH, Condon A (2004). "A new algorithm for RNA secondary structure design.". J Mol Biol 336 (3): 607-24. doi:10.1016/j.jmb.2003.12.041. PMID 15095976.

Ukážkové príklady na skúšku

Nižšie uvádzame pre každý okruh učiva stručný zoznam najdôležitejších pojmov, ktoré by biológovia aj informatici mali poznať. Navyše uvádzame aj niekoľko jednoduchých príkladov. Za príklady tohto typu bude možné pre biológov aj informatikov na skúške získať približne polovicu bodov. Samozrejme, na skúške nepoužijeme všetky tieto príklady a konkrétne reťazce, čísla, stromy a pod. budú iné. Na skúške máte dovolené používať kalkulačku s bežnými matematickými funkciami (nie však zložitejšie výpočtové zariadenia) a ťahák na dvoch listoch formátu A4, ktoré môžu byť z oboch strán popísané alebo potlačené ľubovoľným obsahom. Ostatné príklady na skúške budú prekvapením.

Sekvenovanie, zostavovanie genómov

Sekvenovanie DNA a jeho využitie, osekvenovaný segment (read), spárované segmenty, kontig, problém najkratšieho spoločného nadslova, de Bruijnove grafy

  • Nájdite najkratšie spoločné nadslovo reťazcov GACAATAA, ATAACAC, GTATA, TAATTGTA.
  • Zostavte deBruijnov graf pre k=2 a segmenty CCTGCC, GCCAAC

Zarovnávanie sekvencií

Problém lokálneho a globálneho zarovnania dvoch sekvencií, jeho riešenie pomocou dynamického programovania, skórovacia matica a jej pravdepodobnostný význam, štatistická významnosť (E-value, P-value), heuristické hľadanie lokálnych zarovnaní (BLAST), celogenómové a viacnásobné zarovnania

  • Vyplňte maticu dynamického programovania pre lokálne (resp. globálne) zarovnanie reťazcov TACGT a CAGGATT, pričom zhodu skórujeme ako +3, nezhodu -1, medzeru -2. Napíšte aj optimálne zarovnanie, ktoré ste takto našli.
  • Spočítaje skóre nižšieuvedeného zarovnania, pričom použijete skórovaciu maticu uvedenú nižšie, začatie medzery -5, rozšírenie medzery o jednu ďalšiu bázu -2. Nájdite globálne zarovnanie s vyšším skóre pre tieto dve sekvencie (netreba nájsť optimálne zarovnanie; pri hľadaní môžete použiť ľubovoľný postup alebo úvahu) a spočítajte aj skóre vášho nového zarovnania.
Zarovnanie:                             Matica:
ATAGTTTAA                                 A   C   G   T
A-GGG--AA                             A   2  -2  -1  -2
                                      C  -2   1  -2  -1    
                                      G  -1  -2   1  -2
                                      T  -2  -1  -2   2
  • Uvažujme BLASTn, ktorý začína z jadier veľkosti w=3. Koľko jadier nájde pri porovnávaní sekvencií GATTACGGAT a CAGGATT? Ktoré to budú?

Hľadanie génov

Gén, exón, intrón, mRNA, zostrih a alternatívny zostrih, kodón, genetický kód, skrytý Markovov model (HMM), jeho stavy, pravdepodobnosti prechodu a emisie, použitie HMM na hľadanie génov

  • Pre model na strane 16 prednášky o hľadaní génov (bol by v zadaní) spočítajte pravdepodobnosť vygenerovania báz AGT a stavov modrý,červený,modrý.

Evolúcia a komparatívna genomika

Fylogenetický strom (zakorenenený a nezakorenený), metóda maximálnej úspornosti (parsimony), metóda spájania susedov (neighbor joining), metóda maximálnej vierohodnosti (maximum likelihood), Jukes-Cantorov model substitúcií a zložitejšie substitučné matice, homológ, paralóg, ortológ, detekcia pozitívneho a negatívneho výberu, fylogenetické HMM, likelihood ratio test

  • Na strome na strane 6 v prednáške o evolúcii (bol by v zadaní) nájdite najúspornejšie ancestrálne znaky pre stĺpec zarovnania TTAAA (v poradí glum, hobit, človek, elf, ork). Nemusíte použiť algoritmy z prednášky resp. cvičení.
  • Nájdite najúspornejší strom pre zarovnanie uvedené nižšie. Aká je jeho cena (koľko mutácií je nutných na vysvetlenie týchto sekvencií)? Odpoveď môžete spočítať ľubovoľným spôsobom.
vtáčik biely       ACAACGTCT
vtáčik čierny      TCTGAATCA
vtáčik sivý        TGTGAAAGA
vtáčik modrý       ACTACGTCT
vtáčik zelený      TGTGAAAGA
  • Uvažujme maticu vzdialeností uvedenú nižšie. Ktorú dvojicu vrcholov spojí metóda spájania susedov ako prvú a aká bude nová matica po spojení?
                biely   čierny  sivý   modrý
vtáčik biely      0       5       7       4
vtáčik čierny     5       0       8       5
vtáčik sivý       7       8       0       5
vtáčik modrý      4       5       5       0
  • Uvažujme strom ako na strane 6 v prednáške o evolúcii (bol by v zadaní), pričom každá hrana má rovnakú dĺžku a pravdepodobnosť každej mutácie na jednej hrane je 0.1 (t.j. napr. Pr(C|A,t)=0.1) a teda pravdepodobnosť zachovania tej istej bázy je 0.7, pravdepodobnosť každej bázy v koreni je 0.25. Aká je pravdepodobnosť, že v listoch dostaneme TTAAA a vo vnútorných vrcholoch samé Áčka? Nájdite priradenie ancestrálnych báz vo vnútorných vrcholoch, ktoré má väčšiu pravdepodobnosť a spočítajte, aká tá pravdepodobnosť je (nemusíte nájsť najlepšie možné priradenie).

Expresia génov, regulácia, motívy

Určovanie génovej expresie pomocou microarray alebo sekvenovaním, zhlukovanie (hierarchické, k-means), klasifikácia, reprezentácia sekvenčných motivov (väzobné miesta transkripčných faktorov) ako konsenzus, regulárny výraz a PSSM, hľadanie nových motívov v sekvenciách, consensus pattern problem, hľadanie motívu pomocou pravdepodobnostných modelov (EM algoritmus)

  • Uvažujme microarray experimenty pre 5 génov. Medzi každými dvomi génmi sme spočítali vzdialenosť ich profilov expresie a dostali sme tabuľku vzdialeností uvedenú nižšie. Nájdite hierarchické zhlukovanie týchto génov, pričom vzdialenosť medzi dvoma zhlukmi (clustrami) bude vzdialenosť najbližších génov v nich.
         A    B    C    D    E
gén A    0   0.6  0.1  0.3  0.7    
gén B   0.6   0   0.5  0.5  0.4
gén C   0.1  0.5   0   0.6  0.6
gén D   0.3  0.5  0.6   0   0.8
gén E   0.7  0.4  0.6  0.8   0
  • Zostavte profil (PSSM) pre zarovnanie sekvencií uvedené nižšie, pričom predpokladáme, že v celej databáze A tvorí 60% a T 40% všetkých sekvencií (iné bázy neuvažujeme). Použite prirodzený logaritmus (ln) a pseudocount 1.
AATA
TATA
TAAA
TTAT
TTAA
  • Uvažujte motív reprezentovaný profilom (skórovaciou maticou, PSSM) uvedenou nižšie. Spočítajte skóre reťazca GGAG. Ktorá sekvencia dĺžky 4 bude mať najmenšie a ktorá najväčšie skóre?
A   -3    3   -2   -2
C   -2   -2    1   -2
G    0   -2   -1    3
T    1   -1    1   -2
  • Nájdite všetky výskyty regulárneho výrazu TA[CG][AT]AT v sekvencii GACGATATAGTATGTACAATATGC.

Proteíny

Primárna, sekundárna a terciálna štruktúra proteínov, proteínové domény a rodiny, reprezentovanie rodiny pravdepodobnostným profilom a profilovým HMM, protein threading, gene onthology.

  • Viď príklady o PSSM v časti o expresii

RNA

Sekundárna štruktúra RNA, pseudouzol a dobre uzátvorkovaná štruktúra, Nussinovov algoritmus, minimalizácia energie, stochastické bezkontextové gramatiky, kovariančné modely.

  • Doplňte chýbajúce hodnoty za otázniky v matici dynamického programovania (Nussinovov algoritmus) pre nájdenie najväčšieho počtu dobre uzátvorkovaných spárovaných báz v RNA sekvencii GAACUAUCUGA (dovoľujeme len komplementárne páry A-U, C-G) a nakreslite sekundárnu štruktúru, ktorú algoritmus našiel.
 0 0 0 1 1 2 2 3 3 ? ?
   0 0 0 1 1 2 2 3 3 ?
     0 0 1 1 2 2 2 3 3
       0 0 1 1 1 1 2 3
         0 1 1 ? 1 2 3
           0 1 1 1 2 2
             0 0 0 1 2
               0 0 1 1
                 0 0 1
                   0 0
                     0

Populačná genetika

Polymorfizmus, SNP, alela, homozygot, heterozygot, rekombinácia, frekvencia polymorfizmu ako markovovský reťazec, náhodný genetický drift, haplotypovanie, linkage disequilibrium, mapovanie asociácií, LD blok, subpopulácia.

  • Pre dvojice SNPov, ktorých tabuľky sú uvedené nižšie, určite, či môžeme štatisticky vylúčiť hypotézu, že sú v stave LE (linkage equilibrium) pri hladine významnosti p=0.05, resp. \chi ^{2}>3.841. Pre každú dvojicu spočítajte veličinu \chi ^{2}.
    Q   q              Q  q             Q  q
P  100 200          P 10  20         P  1  2
p  300 200          p 30  20         p  3  2