1-BIN-301, 2-AIN-501 Metódy v bioinformatike, ZS 2018/19

Úvod · Pravidlá · Termíny a zadania · Prednášky a poznámky · Facebook (oznamy a diskusie) (návod a pravidlá)
Zadania domácich úloh a články na journal club nájdete v časti Termíny a zadania.
Pozrite si ukážkové príklady na skúšku.
Rozpis skupín pre journal club je zverejnený.


CB04

Z MBI
Prejsť na: navigácia, hľadanie

Praktické cvičenie pri počítači: dotploty

Yass a dotploty

  • Program Yass hlada lokalne zarovnania v DNA sekvenciach, zobrazuje vo forme dot plotov
  • V novom okne/tabe si otvorte YASS server na adrese http://bioinfo.lifl.fr/yass/yass.php
  • V dalsom okne si na stranke UCSC genome browseru si zobrazte oblast chr21:9,180,027-9,180,345 vo verzii hg38 ludskeho genomu [1]
    • tento región obsahuje Alu repeat. Tieto opakovania tvoria cca 10% ľudského genómu, viac ako milión kópií
    • zobrazte si DNA sekvenciu tohto useku takto: na hornej modrej liste zvolte View, potom v podmenu DNA, na dalsej obrazovke tlacidlo get DNA
  • DNA sekvenciu Alu opakovania chceme zarovnat samu k sebe programom YASS
    • DNA sekvenciu Alu opakovania skopirujte do okienka "Paste your sequences" v stranke Yass-u a dvakrat stlacte tlacidlo Select vedla okienka
    • Nizsie v casti "Selected DNA sequence(s)" by sa Vam malo v oboch riadkoch objavit "Pasted file 1"
    • Nizsie v casti "Parameters" zvolte "E-value threshold" 0.01 a stlacte "Run YASS"
    • Vo vysledkoch si pozrite Dotplot, co z neho viete usudit o podobnosti jednotlivych casti Alu opakovania?
    • Vo vysledkoch si pozrite Raw: blast, ake su suradnice opakujucej sa casti a kolko zarovnanie obsahuje zhod/nezhod/medzier? (Pozor, prve zarovnanie je cela sekvencia sama k sebe, druhe je asi to, co chcete)
  • V genome browseri sa presunte na poziciu chr21:8,552,000-8,562,000 (10kb sekvencie na chromozome 21, s niekolkymi vyskytmi Alu) [2]
  • Chceme teraz porovnat tento usek genomu so sekvenciou Alu pomocou YASSu
    • Ako predtym si stiahnite DNA sekvenciu tohto useku
    • V YASSe chodte sipkou spat na formular
    • Skopirujte DNA sekvenciu do YASSoveho formulara, do okienka vpravo (vyznacit si ju mozete klavesovou kombinaciou Ctrl-A alebo Select All v menu Edit),
    • V casti formulara Selected DNA sequence(s) stlacte Remove pri hornom riadku
    • Pri pravom okienku, kam ste nakopirovali sekvenciu, stlacte Select
    • Zase stlacte Run YASS
    • Pozrite si vysledok ako Dotplot, kolko opakovani Alu ste nasli? Preco je jedno cervene?
    • Pozrite si Raw: blast, na kolko percent sa podoba najpodobnejsia a na kolko druha najpodobnejsia kopia?

Príklady praktických programov

Pozrime sa na niekolko nastrojov, vsimnime si, ake poskytuju nastavenia a co vypisuju na vystupe, dajme to do suvisu s prednaskami

  • viacnasobne zarovnania neskor

Plné dynamické programovanie

  • Balicek emboss, obsahuje programy na klasicke dynamicke programovanie (needle - globalne, water - lokalne), najdu sa na stranke EBI http://www.ebi.ac.uk/Tools/psa/
  • porovnanie lokalneho a globalneho zarovnania
    • Dva proteiny s kinase doménou zarovnáme lokálne, globálne a globálne s tým, že neplatíme za medzery na koncoch
>sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2
>tr|B1AKP8|B1AKP8_HUMAN FK506 binding protein 12-rapamycin associated protein 1 OS=Homo sapiens GN=FRAP1 PE=4 SV=1
  • sekvencie a vysledne zarovnania: CB-aln-dp
  • vo vysledku si vsimnime, kolko ma kazde z nich %identity, %gaps, a kam sa zarovna sekvencia na pozicii 53 v spodnej sekvencii (NSESEAE) a kam sekvencia na pozicii 395 (EDLRQDE)
Lokalne zarovnanie
Length: 645
Identity:     124/645 (19.2%)            
Similarity:   221/645 (34.3%)               
Gaps:         211/645 (32.7%)           
Score: 226.0
VPS34_SCHPO      235-738
B1AKP8_HUMAN      53-627

235 NLDSPAE
    |.:|.||
 53 NSESEAE

549 DDLRQDQ
    :|||||:
395 EDLRQDE

Globalne zarovnanie
Length: 948
Identity:     167/948 (17.6%)
Similarity:   292/948 (30.8%)
Gaps:         341/948 (36.0%)
Score: 130.5
VPS34_SCHPO      1-801
B1AKP8_HUMAN     1-754

 102 NDEEVYE
     |.|...|
  53 NSESEAE

549 DDLRQDQ
    :|||||:
395 EDLRQDE

Globalne zarovnanie s nulovou penaltou za medzeru na koncoch
Length: 1060
Identity:     138/1060 (13.0%)
Similarity:   245/1060 (23.1%)
Gaps:         565/1060 (53.3%)
Score: 206.0
VPS34_SCHPO      234-801
B1AKP8_HUMAN     1-674

265 KIRKELESIL
    ....|.||..
 53 NSESEAESTE

549 DDLRQDQ
    :|||||:
395 EDLRQDE


NCBI Blast

  • NCBI BLAST http://blast.ncbi.nlm.nih.gov/ vela roznych nastrojov (porovnavanie DNA vs proteiny, pripadne translacia DNA na protein v 6 ramcoch)
    • Heuristicky algoritmus, moze niektore zarovnania vynechat
    • rozne nastavenia, vystup E-value

Low complexity masking: nepouzivat pri hladani jadier zarovnania regiony v ktorych sa velakrat opakuje ta ista aminokyselina

  • Priklad (z ucebnice Zvelebil and Baum):
>sp|P04156|PRIO_HUMAN Major prion protein OS=Homo sapiens GN=PRNP PE=1 SV=1
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
  • Hladajme v databaze Reference sequence (Refseq), organizmus human

Bez maskovania vypise napr aj toto zarovnanie:

>ref|NP_065842.1| serine/threonine-protein kinase TAO1 isoform 1 [Homo sapiens]
Length=1001

 Score = 45.1 bits (105),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 27/61 (44%), Gaps = 11/61 (18%)

Query  38   YPGQGSPGGNRYPPQGGGG--WGQPHGG---GWGQPHGGG---WGQPHGGGWGQPHGGGWG  90
            YPG     G  + P GG G  WG P GG    WG P  GG   WG P G   G P G   G
Sbjct  904  YPGAS---GWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMG  961

 Score = 40.0 bits (92),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 10/62 (16%)

Query  26   PKPGGW--NTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGG---WGQPHGGGWGQPHGGGWG  82
            P   GW  N  G   P  G P G   PPQ    WG P  GG   WG P G   G P G  
Sbjct  905  PGASGWSHNPTGGPGPHWGHPMGG--PPQA---WGHPMQGGPQPWGHPSGPMQGVPRGSSMG  961

Ak zapneme maskovanie, toto zarovnanie uz nenajde, v zarovnani sameho so sebou sa objavia male pismena alebo Xka:

>ref|NP_000302.1|major prion protein preproprotein [Homo sapiens]
Length=253

 Score =   520 bits (1340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%), Gaps = 0/253 (0%)

Query  1    MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYppqggggwgqp  60
            MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
Sbjct  1    MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP  60

Query  61   hgggwgqphgggwgqphgggwgqphgggwgqgggTHSQWNKPSKPKTNMKHMagaaaaga  120
            HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
Sbjct  61   HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA  120

Query  121  vvgglggymlgsamsRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV  180
            VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
Sbjct  121  VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV  180

Query  181  NITIKQHtvttttkgenftetDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSsppv  240
            NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
Sbjct  181  NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV  240

Query  241  illisfliflivG  253
            ILLISFLIFLIVG
Sbjct  241  ILLISFLIFLIVG  253

BLAT, chains, nets v UCSC browseri

  • Program BLAT v UCSC browseri http://genome-euro.ucsc.edu/ rychlo vyhladava sekvencie v genome, ale nevie najst slabsie podobnosti
    • Vhodne pouzitie: zarovnanie mRNA ku genomu, presne urcenie suradnic nejakej sekvencie, a pod.
  • Net tracky v UCSC genome browseri nam umoznuju prechadzat medzi homologickymi oblastami roznych genomov

Praktické cvičenie pri počítači: BLAT vs BLAST

BLAT/BLAST

  • Sekvencia uvedena nizsie vznikla pomocou RT-PCR na ľudských cDNA knižniciach
  • Choďte na UCSC genome browser http://genome-euro.ucsc.edu/ , na modrej lište zvoľte BLAT, zadajte túto sekvenciu a hľadajte ju v ľudskom genóme. Akú podobnosť (IDENTITY) má najsilnejší nájdený výskyt? Aký dlhý úsek genómu zasahuje? (SPAN). Všimnite si, že ostatné výskyty sú oveľa kratšie.
  • V stĺpci ACTIONS si pomocou Details môžete pozrieť detaily zarovnania a pomocou Browser si pozrieť príslušný úsek genómu.
  • V tomto úseku genómu si zapnite track Vertebrate net na full a kliknutím na farebnú čiaru na obrázku pre tento track zistite, na ktorom chromozóme sliepky sa vyskytuje homologický úsek.
  • Skusme tu istu sekvenciu zarovnat ku genomu sliepky programom Blat: stlacte najprv na hornej modrej liste Genomes, zvolte Vertebrates a Chicken a potom na hornej liste BLAT. Do okienka zadajte tu istu sekvenciu. Akú podobnosť a dĺžku má najsilnejší nájdený výskyt teraz? Na ktorom je chromozóme?
  • Skúsme to isté v NCBI blaste: Choďte na http://blast.ncbi.nlm.nih.gov/ zvoľte nucleotide blast, database others a z menu reference genomic sequence, organism chicken (taxid:9031), program blastn
  • Aka je dlzka, identity a E-value najlepsieho zarovnania? Na ktorom je chromozome?

RT PCR sekvencia z cvičenia vyššie

AACCATGGGTATATACGACTCACTATAGGGGGATATCAGCTGGGATGGCAAATAATGATTTTATTTTGAC
TGATAGTGACCTGTTCGTTGCAACAAATTGATAAGCAATGCTTTCTTATAATGCCAACTTTGTACAAGAA
AGTTGGGCAGGTGTGTTTTTTGTCCTTCAGGTAGCCGAAGAGCATCTCCAGGCCCCCCTCCACCAGCTCC
GGCAGAGGCTTGGATAAAGGGTTGTGGGAAATGTGGAGCCCTTTGTCCATGGGATTCCAGGCGATCCTCA
CCAGTCTACACAGCAGGTGGAGTTCGCTCGGGAGGGTCTGGATGTCATTGTTGTTGAGGTTCAGCAGCTC
CAGGCTGGTGACCAGGCAAAGCGACCTCGGGAAGGAGTGGATGTTGTTGCCCTCTGCGATGAAGATCTGC
AGGCTGGCCAGGTGCTGGATGCTCTCAGCGATGTTTTCCAGGCGATTCGAGCCCACGTGCAAGAAAATCA
GTTCCTTCAGGGAGAACACACACATGGGGATGTGCGCGAAGAAGTTGTTGCTGAGGTTTAGCTTCCTCAG
TCTAGAGAGGTCGGCGAAGCATGCAGGGAGCTGGGACAGGCAGTTGTGCGACAAGCTCAGGACCTCCAGC
TTTCGGCACAAGCTCAGCTCGGCCGGCACCTCTGTCAGGCAGTTCATGTTGACAAACAGGACCTTGAGGC
ACTGTAGGAGGCTCACTTCTCTGGGCAGGCTCTTCAGGCGGTTCCCGCACAAGTTCAGGACCACGATCCG
GGTCAGTTTCCCCACCTCGGGGAGGGAGAACCCCGGAGCTGGTTGTGAGACAAATTGAGTTTCTGGACCC
CCGAAAAGCCCCCACAAAAAGCCG


Skórovacie matice

Chceme určiť skórovaciu schému pre zarovnávanie dvoch DNA sekvencií (bez medzier). Máme dva modely, každý z nich vie vygenerovať 2 zarovnané sekvencie dĺžky n.

Model R (random) reprezentuje nezávislé náhodne sekvencie

  • Použijeme naše vrece s guličkami označenými A,C,G,T, pričom guličiek označených A je 30%, C 20%, G 20% a T 30%.
  • Vytiahneme guličku, zapíšeme si písmeno, hodíme ju naspäť, zamiešame a opakujeme s ďalším písmenom atď až kým nevygenerujeme n písmen pre jednu sekvenciu a n písmen pre druhú
  • Máme jednu sekvenciu ACT a druhú ACC. Aká je pravdepodobnosť, že práve tieto sekvencie vygenerujeme v našom modeli R?
  • Nezávislé udalosti pre jednotlivé písmena, t.j. Pr(X1=A)*Pr(X2=C)*Pr(X3=T)*Pr(Y1=A)*Pr(Y2=C)*Pr(Y3=C) = 0.3*0.2*0.3*0.3*0.2*0.2 = 0.000216
  • Spolu máme v modeli 4^{6}=4096 možností ako vygenerovať 2 DNA sekvencie dĺžky 3

Model H (homolog) reprezentuje zarovnanie vzájomne súvisiacich sekvencií

  • máme vrece, v ktorom je napr.
    • po 21% guličiek označených AA, TT
    • po 14% označených CC, GG
    • po 2.4% označených AC, AG, CA, CT, GA, GT, TC, TG
    • po 3.6% označených AT, TA
    • po 1.6% označených CG, GC.
  • Spolu máme 70% guličiek označenych rovnakými písmenami, 30% rôznymi
  • n krát z vreca vytiahneme guličku a písmená píšeme ako stĺpce zarovnania A1, A2,.., An.
  • aká je pravdepodobnosť, ze dostaneme ACT zarovnané s ACC?
  • Pr(A1=AA)*Pr(A2=CC)*Pr(A3=TC) = 0.21*0.14*0.024 = 0.0007056

Skóre zarovnania je log Pr(zarovnania v H)/Pr(zarovnania v R), t.j. log (0.0007056 / 0.000216) = 0.514105 (pre desiatkový logaritmus)

  • kladné skóre znamená, že model H lepšie zodpovedá dátam (zarovnaniu) ako model R
  • záporné skóre znamená, že model R lepšie zodpovedá dátam

Cvičenie pri počítači

  • Stiahnite si súbor [3], uložte si ho a otvorte v Openoffice
  • V záložke Matica vyplňte do žltej oblasti vzorce na výpočet pravdepodobnosti krátkeho zarovnania, logaritmus pomeru pravdepodobnosti a súčet skóre, pričom vo vzorcoch použijete odkazy na políčka v riadkoch 9-13, stĺpcoch B a E
  • Súčet skóre by mal zhruba rovný desaťnásobku logaritmu pomeru - prečo vidíme rozdiely?
  • Potom skúšajte meniť %GC a %identity v horných riadkoch tabuľky a pozrite sa, ako to ovplyvní skórovanie. Výsledné skóre zo stĺpca E ručne prepíšte (bez formúl) do tabuľky v záložke Výsledky. Prečo nastávajú také zmeny ako vidíte?